/usr/lib/.build-id/b7
NameSizeModeActions
0fe8a8bcb76a7f0fd97feb8161a49b12551304623360755editdlrm
2c551263ed75c3592bf6ee97b7193cd0b803b4-0editdlrm
36ee4b6cfb58a507b34f1741bd6bf3383e8095206320755editdlrm
269e3f355dbba755fe2be20cc0e7a75a6cd2903474160755editdlrm
343f92ce8bd3ab67020eca31313702e82e222e3886160755editdlrm
084568b4113f31e4124c4ff74501136c6c9470120560755editdlrm
abd2637c8c16c7a2630a2c030f576d15728bcf420960755editdlrm
acb652dc60084f51447b1fbc4be5c73276c2bf1475680755editdlrm
b1705b213602b1bd3f79fc04533b5dadb51a23120560755editdlrm
c7c86c402f653429d84c29e76fb456ea7678891005040755editdlrm
daddefbd6109b95be6ae12ba5eb0dd0257711a446720755editdlrm
e2a138e41b543ba4cab3c88191ec84a63c73a2721920755editdlrm
e128fc8ac754d5e685a698efa03c5ca59fbbbb513520755editdlrm
Edit: /usr/sbin/mdmon (388616B)
ELF>t@H@8 @@@@hhX;X; pGpG%pG%Xy@ (H(H%(H%   DDStd PtdQtdRtdpGpG%pG%/lib64/ld-linux-x86-64.so.2GNUGNUGNU4?΋ӫg117.".A! (BE|fUaqX93m[ 140)H.OzFjXS3K'9sIfe!-].!W u( {^nAT0uPz6_tH*Qo 8M_D(P<_fg"Pla|SWg:r7 5EY" |B &%%&%% %c%libdl.so.2_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTabledlclosedlsymdlopenlibudev.so.1udev_newudev_monitor_enable_receivingudev_monitor_filter_add_match_subsystem_devtypeudev_unrefudev_monitor_unrefudev_monitor_new_from_netlinkudev_monitor_receive_deviceudev_monitor_get_fdlibpthread.so.0nanosleepacceptconnectpread64lseek64pthread_attr_setstacksizefsyncwait__errno_locationsigactionpthread_attr_setdetachstatepthread_createpthread_attr_initpthread_attr_destroylibc.so.6socket__stpcpy_chkglobfree64fflushstrcpy__printf_chkexeclfnmatchsprintfstrncmpoptindstrrchrposix_memalignpipeperror__open64_2ftruncate64mmap64__fdelt_chkclosedirglob64strncpyforksigprocmask__stack_chk_failunlinkputcharlistenmkdirreallocabortstdinstrtollgetpidkillstrdupcreat64strftimechmod__assert_failflockstrtokstrtolfeofsymlinkfgetsgetpwnamgetppidcallocstrlenungetcsigemptysetmemsetstrstrstrcspnbindchdirmemcmpstrndupdup2__fxstat64poll__fprintf_chksigaddsetctimegetgrnamstdoutfputcfputsstrnlenmemcpyfclosepselect__memmove_chknftw64strtoulmallocumaskstrcasecmpfdopendirrealpath__strncpy_chk__lxstat64__xstat64__ctype_b_locgetenvsscanfstderrsigdelsetioctlsystemsetrlimit64munmap__snprintf_chkreadlinkfscanfgetopt_long__strncat_chkstrncasecmp__xmknodstrtoull__realpath_chkfilenogethostnamechownfwritefreadgettimeofdayrename__memcpy_chkmlockalllocaltimestrchrfdopenreaddir64qsort__strcpy_chk__cxa_finalizesyscall__vasprintf_chksetsidfcntl64fcntlgetrlimit64__sprintf_chkmemmoveunamefopen64access__strcat_chkopenat64strcmpstrerror__asprintf_chk__libc_start_mainferrorstpcpyrandombasenamesnprintffree__cxa_atexit_edata__bss_start_endGLIBC_2.2.5LIBUDEV_183GLIBC_2.28GLIBC_2.7GLIBC_2.14GLIBC_2.3GLIBC_2.27GLIBC_2.8GLIBC_2.3.3GLIBC_2.15GLIBC_2.4GLIBC_2.3.4        ui f #6 ui  ii ( 2ii = Gii Rsi \hii sui ti }pG%txG%tG%G%G%|qG%\zG%`zG%ezG%ozG%jzG%szG%zzG%rKG% tH%JH%H%AH% H% P%|1@P% `P% P% P% R% XT% T%#T%!KT%#T%#T%#T%#T%#T%#T%#T%#T%#T%JT%qT%#U%#U%$ U%R%(U%P%0U% %8U%%@U%%HU%@%`U%5(pU%r0U%o0U%dyU%v0U%0U%0U%0U%#U%0V%0V%0 V%00V%0@V%0PV%0`V%0pV%#tV%0V%0V%0V%1V%1V% V%yW%#W%q W%#0W%#@W%#PW%#`W%#pW%JW%#W%$W%%1W%>#W%#W%dyX%qX%r0@X%-1PX%=1`X%@1pX%KCX%O1X%`1X%c1X%s1X%v1X%1X%1X%1Y%#Y%1 Y%>#0Y%1`Y%1pY%uxY%1Y%1Y%1Y%1Y%1Y%1Y%1Z%X$Z%vp Z%<0Z%1@Z%opPZ%TC`Z%1pZ%1Z%'Z%XpZ%%Z%1Z%CZ%2Z%2Z%_p[%cp[%HK [%#u@[%0P[%0`[%TCp[%XC[%2[%2[% 2[%12[%@2[%1[%P2\%S2\%V2 \%l0\%Y2@\%f2P\%r2`\%2p\%2\%2\%2\%2\%2\%2\%2\% 2]%12]%@2 ]%10]%P2@]%S2P]%V2`]%lp]%Y2]%f2]%r2]%2]%2^%%^%mJ^%J^%>^%>^%>^%1^%0^%>_%#_%?_%>_%? _%?@_%#H_%<@P_%<@`_%@h_%+@p_%>@x_%! @%%H%%P%@%X% %`%|%h%x%p%r%x%j%%f%%1%1%1%ux %1@%I`%I%I%1%1%I%I %I@%1`%I%I%I%J% %J %%J@%*J`%1% %2J%'%?J%GJ %J@%MJ`%3%VJ%3%]J%hJ%uJ %J@%'L`%#%J%J%#t%dy%J %J@%J`%J%J%bC%0%J%0 %0@%J`%J%0%0%5(%%K % K@%K`%K%eC%)K%3K%#%?K %DK@%OK`%WK%\K%`K%#%eK%oK %(@%{K`%6$%K%K%K%K%0 %K@%K`%K%>%K%K%$%K %K@%K`%K%K%K%L%L%!L %2@%,L`%1%ȶ%ж%ض%%%@%%<%%P %(%0%8%@%-H%hP%PhX%@`%`h%Pp%x%%%% %%Py%% ~% %ȷ%з%Ёط%pw%t% %0%g%а% % %K % (%0%@8%@%H%P%X%p(`%'h%@*x%u%P %%p0%@%x%`%08%T|@%`$%#غ%%%!%!8% @% %| %@(%`0%8%H%7P%`<X%x%@r% y%:%% %6%%ȼ%Fм%Pcؼ%ph%`7%%%@/ %o(%pr0% C8%X% 1`%h%p%x%L%K%ؽ%%%%(%/@%7P%=`%Cp%I%!%O%V%[%bо%i%q%w% %0%`%p%%ώ%%п%%%%m% %0%`%p%%O%O%EO%WO%O%%%% %`J%hJ%pJ%xJ%J%J%J%J%J% J% J% J% J% J%J%J%J%J%J%J%K%K%K%K% K%(K%0K%8K%@K%HK%PK% XK%!`K%"hK%#pK%$xK%%K%&K%'K%(K%)K%*K%+K%,K%-K%.K%/K%0K%1K%2K%3K%4K%5L%6L%7L%8L%9 L%:(L%;0L%<8L%=@L%>HL%?PL%@XL%A`L%BhL%CpL%DxL%FL%GL%HL%IL%JL%KL%LL%ML%NL%OL%PL%QL%RL%SL%TL%UL%VM%XM%YM%ZM%[ M%\(M%]0M%^8M%_@M%`HM%aPM%bXM%c`M%dhM%epM%fxM%gM%hM%iM%jM%kM%lM%mM%nM%oM%pM%qM%rM%sM%tM%uM%vM%wN%xN%yN%zN%{ N%|(N%}0N%~8N%@N%HN%PN%XN%`N%hN%pN%xN%N%N%N%N%N%N%N%N%N%N%N%N%N%N%N%N%O%O%O%O% O%(O%0O%8O%@O%HO%PO%XO%`O%hO%pO%xO%O%O%O%O%O%O%O%O%O%O%O%HHY$HtH5$%$hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hh%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D% H  I B % H\$I BDpB % 1Hp0 H IcH  1L I@(AD$ AD$%  % fAWAAVE1AUE1ATE1USHH`H$E1H $HމH+<hFu,EE1fDtuCAA롐a AHc_%AHDH$rf=]H8@@QEu+A@H=b,fH=U f.H=f.H=ſ?f.H=tuHOtH@E H<$+-]%H4$ H=EH<$ 11IĉD$HHIHcD$1L5^HD$fDIGHHtW HL€u@@ <-t51HLDHHAH9DLG DMXMuHߑH[]A\A]A^A_Hc\%HHH5H6uHH6\H$HEEH<$1ljKHHt=HDDH[]A\A]A^A_H<$HT$1H<$L L$1H=9\%H JH1 D1I^HHPTLH H=$H=L%HzL%H9tH~$Ht H=QL%H5JL%H)HHH?HHtHU$HtfD=m[%u+UH=2$Ht H=$)dE[%]w%Ðff.S1HlH߉_%N"1[f.HIH=Z%1H ѭHHff.UILdSH HHxdH%(HD$h1HHHuIdHL4H B1pHHHD$hdH3%(uHx[]ff.AWAVAUATUHSHHT$ dH%(H$81N^AąHD$(H H&Lp|H1LALDHCpCxDIHuxHI9EM<LhnHHLMHǃMt>D}L;HHHHHMMuLL$GL/L LL11L$ 1HXL H$ DŽ$L1ҿHH$ L1ҿ HDŽ$ LsAŅH=pHHDHDAH='yId1L$LLH L纀1RAąR L$AH XL1|LLDHDIEJ|%Id1L$LצH LL1ҾAƅ@Hl$0lLH,fD$0H}1?0nHD D1ҾD1DHc1|$,DsxD$#Hr%HtHH|$ HHHtDf.'1=%tH1%%Ee1wH41jf.LX\H=AL$ EED]DHHDHDAH1@؅DH|$(|$,H\$r|$(HH|$(ND$pDHt$H|$,f.A9rMcźd1H$H LH1H1Aą5ǺcH6DƄ$3IE H5+HHDE1ҾD1+DHc1HdD!1 W~ DAytH=R%H H1'H$8dH3 %(HH[]A\A]A^A_H5HH@EDf.HHDH/DNElh;H=$R%H 0AHƣ1gf8H=Q%IH IH1-|$(f8DH=Q%H IHϡ1HAD$D$AHl$0.DAUIH NH/H=(Q%1|pIH %HH=P%MH HG=MH HH=P%MIH ģH IH HL8H=hP%H tIH21aPXH=CHH P%Y/ff.@1ffD1fH9% H1*f.USHHHމHsH[]ff.ATA1UHDS1SHDHc~#HcDHT: t []A\@[]A\[E1]A\DUSH8dH%(HD$(1x;HHHq~"H=Hu#HEHD$(dH3%(u H8[]@ 1HqHEfDATUSHdH%(H$1xEHIH޿Wt)H|$t!A;$~A$HcHH TH$dH3%(u HĠ[]A\DATUS1HpdH%(HD$h1HdHHL%fLH5H5HEH5HڃEH5BHڃEH5HڃEџ,HڃEHtHHhHL$hdH3 %(u Hp[]A\pAUMATMcUHSHHHvTHtLLI9t)HHH HʠРH[]A\A]H[]A\A]AWAVAUIATAUHSHHHMcHL0E~KMx1ALv HA9t.HcxHHH9uI9tNNHI9wAuTHAHAuTDHA~8H[]A\A]A^A_fDAQ9}ICoDAPH͟H LHƟff.@AWAVAUATUS1H|$LLd$pL|$hHt$(HT$0L$$LD$8dH%(H$1HD$dD$HHD$HD$_HD$HD$`HD$@HD$HD$@|$LH)I4`|$H,HcDpLL$LD$LLHL$1H5ѝLME1IDA<|$_ 1L$`%|$$HT$hLD$8Ht$0H|$(l$dA9LcLL$LD$LMHL$1H57La…mmL|$$MMIt{LL)D$HHHHD$@@DL$dHt$0MH|$(PfH$dH34%(uAHĨ[]A\A]A^A_Ë|$L11HJ@fAWIAVAAULopATUSHdH%(H$1Hl$@D$,HHI_pLd$,Ht<< +MM~H|$1E1A QH1u,I1LH@AAdžPuILH@AƒDupAi H$@@H| H=*Ht2ILH@ AdžE'MD$AӃtrIAuTLHHAt AAu'I1LH@AAdžA܃v AMMpA IHt$H9HHH)IHH9II1LAH@@I;v HD$IHD$I9w IdžIHPA tH=$AHAdžZH$@1A(LHH2HH=ߌIIAAA A'81HHI1LA@H@A urAAL~IHA~|$tD$AA 1A@lj|$MAM/ff.@SHHh1y[AUATUSHL'MtRIID$ I\$I|$IEI|$HtH+HHHuLMeMuH[]A\A]ÐHmh% H1Zf.AUI0ATUSHy\FLHHLHHǀHǀHǀIHtOIDx#\H3;HHI$LHHHHuI$HH[]A\A]ff.@UHSHHHtiHt#HHHHHuHH[]pHHuȋxyxjx[xLx=x.H,fH=yf%HtH$ҺHEHL$dH3 %(uvH@HVH$VfHVHH$VfDHVH$VHHVH H$VfDHVHH$Vo莭ff. ЃSHHdH%(HD$1Pv@E1҅ADV9uHcAA|ttE19AD@tE19AD@UE1SAҍj@EtT$=I\$L$*H=% T$< HjHHD$D$ D$ D$)Hc D$( 1HH cH|$æH=|%HHNeI1î@AT1IUSHdH%(H$1mH=t%1H$dH3%(H[]A\HHnH=uH4H=dHt H=dHuH=%M1H bHiڭL$D$HtdH=b% $ 1HcH衭$¥fATIUHSHdH%(H$1H uuËD$%=`u;Ht HD$(HEH$dH3 %(uuHĠ[]A\H=%M1H aHhf蛣1ۋ8H=k%MH yaIHwc1諬vѤATIHUHSHdH%(H$1H(utËD$%=`u:Mt HD$(I$H$dH3 %(utHĠ[]A\fDH= %I1H `Hgf諢1ۋ8"H={ %IH `IHb1軫wAULL-bATIUSHxdH%(HD$h1HH= %HL1\H= % H %dH謥Ht8$@ΙfDDB@B@D1DЃt HcL!I~LcMLAUATUSHH $HHLyYdH%(H$81Hl$0IHH躗11HnH=aXHuHSHDPDH=2YHt*1H$8dH3%(HH[]A\A]軡HSHDPtHt$H{ ٟD$xHT$H9v:uHH H!H {Ll$ǺL蚚IEMc1HL$HH5>XLBD$E $T$HHH HH!%H H HHH H!H Ht$H{ D$HT$H9:HHH H!H%HH ȁH HHH H!H Lff.@H5q+ff. H5` ff.IHdH%(H$1H=VLuuLHH=%ZH=%^t(HH5%FuD$%=`tR1H$dH3 %(uFHĨDLQV1H=1%|f.H%BfH H= VHtfDH鰔AUI1ATIUSHHdH%(HD$1HH̜H<$A$H9v?:t"1HL$dH3 %(u;H[]A\A]DtH1H脜AExH$8xfAWAVAUATUSHHdH%(HD$81HHT$HH@uACMff.fUIISII H arAE0ɺH(dH%(HD$1@H HA 1A H蜛1Hrx.É߉IH<H<f1f1HT$ HMDD$\$H-q)L:H|$Ԏ@HtGSHHHS P SPSXPXHSPH@0HPPH@8[f1ff.fAWAVAUATUSH|$ dH%(H$1#@L5|$IM\HD$ E1D$H-u|$D$HD$'fDu.It$INtMEuItIL1IH1ILJH)HAGXLt$ AuI1Ht$LP`|$D$,t;D$v D$Dl$ILANtM^t$tdILLLcHI1ILJH)HAGXLJDt$ uJDL fLE1H$dH3%(LuH[]A\A]A^A_舌ATI1USHdH%(H$1HHHHHLM1H=$H HHOӓH1Ht$HP`HHt$ D$H=($HD$~)H|$HHHKHDcDD$,H=$IHHO1^H$dH3 %(EH[]A\fD1@H=$M1H GHfO(ATIUHSHdH%(H$1HT$etD$(%=tx1Hru;H$HEH$dH3 %(Hİ[]A\f1HT$`譋uHD$H fDHD$@뚐1MtԈ8MH=$MH FIHrN1c ff.ATIIH .iUII SAE0HH dH%(HD$1@H HA 1A HWH11+xH1AXDŅu'HL$dH3 %(uH []A\Ê7UHhSHHdH%(HD$1HT$Au-D$HL$dH3 %(uLH[]f1HtT8͐H=&$IH 4EIHM1f菈ff.@ATIIH gUII SAE0HH dH%(HD$1@H HA 1A HאH11xH1ADŅu'jHL$dH3 %(uH []A\C跇AW1AVAUE1ATIUSHHdH%(H$81HH\$ 1+Hމ\H=u7f$UALt$tM1LtD$ I$I$H$8dH3 %(DHH[]A\A]A^A_ÐHHS@t0I9$sI$HH9uALt$tI$f1Lt$)$ LD$St$1҉.H$ ZH=HEFI PARTAH9$ $p$tD$ =L$1҉L$0L$ 4 觍D$ 1H $u6`DIIWI3EI3UH tH$XI;$vI$9\$ t,H$L蓇H;$tDE1CA8A-eDS@1HdH%(HD$141Ht'H:1H1t 1H<$HL$dH3 %(uH[ff.ATIUHSHHdH%(HD$1H1~9IH +AH4IHtUH$H9w>MtH AHIL9w41HT$dH3%(u:H[]A\fH @H:IH=$1#AWAVAUATUSHdH%(H$1HT$0ggHD$XL$H CLLIHDH IH %0AA A 1JUH!%tLDHUHDHIHH$H$HD$,HD$HD$(HD$L8HH8tx.tHXH1IH ?CH蟋1L1賈AƅxH4$輄DI1AG=wIcH4$H=BƄA WO$/AIH BHH1L1Å L<$LHD$莃HT$B=HcHL$1LƄHT$H5a赆H$DL$,1DD$(H `HcH19ÅoLWDLHH$dH3 %(uH[]A\A]A^A_GATUSHo$Ht,IH-o$ HH]HtHL蔃uH[]A\<-u MD1DU1SH<-u*HH/HtHxH1&@H[]HWHHt[I H=:Hu;J -u'HLHz Hf.1DAUATI1UH1SHIHtbHHHUtHHSHLH| Ht$H[XHuLH[]A\A]fD1DAW1AVIAUAATIUHSH6ljHHM| HHhAHy.IH-xt4E;L+߻gH[]A\A]A^A_fDH<HHD$|HEH}|HHt1҉HЅHEHLHH|Lo*sf.ETMH :HCH=$1߻+fE H=p$H :H D1超EMH U:HC@MH >:H$>H=$1lELD$H :H\CfElMH 9HC@EtRHEH>fE;H=$M1H 9HxB΄H=b$MM1H k9HDC袄Ht_ATHUH1SAXHHHHEAąuHHu0HHt$H9uD[]A\HQH! @1}v ;HHHHHH벐HIIȋtH 8HXLL9HAPILHH HH!" H H HHH H!1H |HXHdH%(HD$H1HuHHfH# H@D$H$1BB(B8|HL$HdH3 %(uHX+#H@{ff.HHHt#fHHH9HGHuDATIdUL&4H *4SHĀdH%(HD$x1H\$HL11H[xWHl$Ǻ Ha|I{E~2 1H}HL$xdH3 %(uH[]A\f.z@H31҅~1}1҅‰HfDS1H=b:HdH%(HD$1xEHt$lj{Ht }D$ {D$HL$dH3 %(uH[f}dy@AT1IH=9USH dH%(HD$1x ǺL{Hzt"HHkS}HCH9ufo$A$HD$dH3%(u H []A\xff.@H`ATUHHS1Aąy:zHC 1HDHE`1DH{vHvH]`Hu1D 1DcDyHEh1[]A\HGhøATIUSH(&HShL`(H@H@H@ HH HCh[]A\@AWAVAUATUSHXHL$LD$DL$dH%(HD$H1HH@hH/HIIHH@<LHD$@HD$(HD$4HD$ MEuXEAELAUPHHH HH!HH H H H!H H}MAM-蝳H|$HD$@HtHH|$(1H5o$hHD$@HT$LH胸H|$@ILHIDžc"L+MH\$HdH3%(LHX[]A\A]A^A_f.HHt$8HT$HT$tHD$8H9EEkHt$ HHT$IQD$49EHT$?Mt AE'T$IAD$<Iu I1{!IDž뺐E1CuSH0dH%(H$(1HtdHHt\HHtuHH$H޿{tu/H$H9L$u H$H9$ H$(dH3 %(u H0[tfUSH(dH%(HD$1HHxu&EH9$sH;D$vHD$H޿H$ uHD$dH3%(uH([]tff.ATUS1uH=41y1t1tu[]A\H=h4\sHHHyHtH-R4L%J4HyHtHHH€tعHL€t1 Hv~t@H=$[1]H /H9A\zff.AUIATIUSHHdH%(H$1HHAUMHULl3HHDغ1SpE1H1H`>H5Q3H=A3zE1H1H=13H7>H5(3rzyAUIATIUHH=3SHdH%(HD$1t)1HL$dH3 %(u@H[]A\A]f.iztͅt H|$zxD$1ۅqLLHfAT1IH=2USHlTH@dH%(H$81Hl$0wH=x2Hl$HD$(H12HIHB2HD$HB2HD$ t.1H$8dH3 %(H@[]A\HH51LuHH=1p~jH/HD0NqHPHHкnHDmdmofPyÃu5H=$H ,H0714xCD$0tJH|$ xx D$ H=$H ,H 71wpH\$H?uHH;Huew1LH1w@H1H=0vHUSHHq1Hx9u H[]@Hމ[]ofS qH=v0HHS$fsHHD$H;HtSH5V08wH;H5W0HC%wH;H5T0HCwH{HCtH{tHt$[H;[sff.@USHdH%(HD$1$t|H$HHPÃtHL$dH3 %(uZH[]@Hi$HH<$1H5/PuHJ$H<$PfH}2l׻m@S@H=d/HH $rHH$H;HH5B/uH;H5F/HCuH;H5H/HCuH;H5K/HCuH;H5D/HC uH;H5D/HC(uuH;H5?/HC0buH{HC8t7H{t0H{ t)H{(t"H{tH{0tHt=$[H;[qHHzf.AV1AUAH=.ATUHSH1{r!H 1DAH?tHH E1EH11pIHHI4DH)kHxHH9u17fDjtH={$H (HM3þ1sHLDqD\m[]A\A]A^Ð[jH=4$H @(H2؉1tsf+jH=$H (H-؉1DsH=$H 'Hx-1skAVAUATUSH dH%(HD$1Ht$H$Hɚ;AAIHiAHfDuUEtPEHH\k}trHMEPH=$1H2H "'`rXZHD$dH3%(u,H []A\A]A^H 3 H5(H=,BkMjff.fAVAUATUSHPr$dH%(HD$H1JH=;$fŅ^ "H=$HH$H$PHH}$H;sL$H=%$1H 4&H1kqH@1L $L+@HL%oL-%g 1 H=$IAI!%tIؾDIQLDHWH:$IHjA)jWATH?jP AH0WgILDH="$H01tpHM$x .H0H$H=$PHt$HdH34%(DHP[]A\A]A^fDH$H=m$PHH$H8LO$H=$1H $H/AoyH$H8H$@uaANH=1$H =$HF/Aso$H $HP/H=$1AGoH #H)]gff.fAVAUATAUSH dH%(HD$1I(H RFLIIH II %AE0A A 1o)uKi@B1yB؃tXDL@΀9Aƅye uAt HL$dH3 %(Du%H []A\A]A^E1uACfAUATIUSH8dH%(H$(1HhD$%=`utL$#i@B1B؃teLL=euɋ$%=`uHD$(H9$uH$(dH3%(u;H8[]A\A]H=$M1H !H'm-eff.fAUAATIUSHہ,f{c8u2t*1L" D1eŃtH[]A\A]AUAATL%m!USHہ(Db8u=t51 LDcŃtƃ@@H[]A\A]ff.SHHHdH%(H$1Hku2D$%=@H$dH3 %(uEHĠ[D3b8kH=$IH  IH1Ek1lcff.SHHHdH%(H$1Hnju2D$%=H$dH3 %(uEHĠ[Da8jH=U$IH cIHb1j1bf.fHHt;wu >D;wt3HHHuPH .H5',H=',Wcff.HHt;wu D9wt HHHuDUHSHHH?HufDHH;Ht H|duCH[]f.@HtoATUHSH}(_H}0_H}H_H]PHt @H;Lc_HL_MuH]XH_Ht HfD[]A\AWAVAUATUSH|$t$ dH%(H$1ۅt6X$H5H=%:dIMLd1fHD$XLHD$XHD$ HD$IHLH=, LH=,txH=,Lt^LH=) AAAu=L`HHw,MgA_hHBD`fLؼL0IH4L$Iƅt =V$lL4_T$ HD$Xt"Hu }DHHPXLpXIHuH$dH3%(HĘ[]A\A]A^A_@11 gHt'`xH5D~dIM4f1@Ld$`H LHLa`"L HI@ H@(LH@0IF8IF@IFHIFPIFX|aMgM9Ll$(HiMHD$DAE Md$M9tGLHtع LH=JuNMd$AE M9uHT$MLl$(HHH}IFXLL2ֺLH=C*tAu ~ I}(H=L[L]IH M)LLLt$8HD$0b_HT$0LH=(HIEPHBAE@IUPHD$ H9D$Lt$XMtgl$0HLl$@Ll$8L|$HMLt$IoXI9MXMtL\L9uLLLo[uHLl$@l$0L|$HHD$(LH=(u&Mt$M9tLMIEHL(\E4$IA[A}8LH=uIcA|%rArHAc>A0A xIcA|%i 1L_AE8Qf1AfA<$(LIE(HD$LL0IFXHD$Orf.L(_\ljOR$1(agHD$0cIL$LD$0HHDHI}0Ut _I|$LD$0"LD$0IE0IcHD8]PHH=LuAE<H=>LuAE<H=&LuAE<H=<LuAE<A~|Mc H=&KDH€uAE8Hƹ H=&uAE8KtH=V&MAE81>8A=LLD$0YLD$0Hn1Hx \H=CLAE8@@@u:AE<I|$ 1m\AEDl$0Ll$@L|$HH=f=L@@@u AE<kAE<1\Xff.@=O$yO$HZO$HUSHcHdH%(H$1Hl$HHHc=UO$xdXFO$IH$HD$֍z 21҃?)HHH t1[H$dH3%(uHĨ[]øWAVAUHIATUSHdH%(H$1ILHH$HHHHc=N$x&W {N$у?)ѺHH ąyL19TN$MLHMDN$E11҉߃UWH$dH3%(upHĠ[]A\A]A^fH$AVY$HcI%=tWL ĀofVL 4XVff.fAT1UH1SIHt8HH[XHtHHXuLc[]A\1AU1ATI1USHHHL-&HEHHtJ HL€u3@ <-u(H]XHEXHHt_HHEHHuH]PHuDH[HtH;L XuH}XHEXHH[]A\A]fH1[H]A\A]AVI1AUI1ATL%XUSHHfHCHHkXHCXHtS HL€u@11L|KH0HDžLH=v5$AfD11HFI%E4H5 HLHtAEnXE0EE<Ct*8u.t*Ht8u u11u,wHH@IH6Ht5IE1fEHIK4HtLEdtDE1ATUSHdH%(H$1HHEt(1H$dH3 %(H[]A\HH$LxHIx1@1H1HŅxǺxHDIDEqAxgMc 1HBƄ$DHFGBATLxLUHH %SHĀdH%(HD$x1HHxHHDRxH߹xP1@X1ZHGxSHAHHAI*CHEAI9HL$xdH3 %(uH[]A\lAff.AUIIH NAT2IUHSHHdH%(HD$81HHILHLHHT$8dH3%(u HH[]A\A]@fAUIIH AT2IUHSHHdH%(HD$81HHZILHLHIHT$8dH3%(u HH[]A\A]i@fATxLxUL7 HxSHĀdH%(HD$x1HH9>1HExVH?HHO?IeAH?D9HL$xdH3 %(uH[]A\f?@SH {"LxL` HdH%(H$1HHxxHDH$RxHP1[=HT$H޿>ZYH$dH3 %(u H[>ff.SH !LxL HĀdH%(HD$x1HHxHHDRxH߹xP1DAT1I1USHPdH%(HD$H1H\$E2Hމ@~^2tYHHt$1HDC@I$HD$H9t<1 !HL$HdH3 %(uHP[]A\ٸ=ff.fUHSHx"H߉>H[]@AUAATUH1SH1HxdH%(HD$h1Ld$DPLD ?PHLH1D6?H<$HEL9t< ƒ tHHD$H;$t)v1HEHH\$hdH3%(u:Hx[]A\A]f.HHr븸뽸1ALHH<~PL H!%tDHJHDщ@HL)Hv|$y-|@Q)kd)Ճ~1LHHH=$H H1?@HH1H|AąW\68D AH1HmH@Hc$1HHA%Hc 1HHA HcKD 1HvH ŃH=E($1HoHHH=}$H H1>ǃ@D$ -~fDH=9$H JH1>06DAWAVAUATUSHH $HH $H8H DNPDFLdH%(H$( 1Hl$ IHHAպ>H1LHŅt2H$( dH34%(H8 []A\A]A^A_H$ 1H׋SLHCPHHH HH!ʁH H HHH H!H ʃƃ|H|ǃxdev-H:EtHHHtHLHHLHHHH A|$tBA$~HHcKTxHHLv E+H WHdHLd|tH=$1H HW:fDH5LdH5sLHudH$H=$MH HmSfDIL_D$(H5L H5LH$H=r~$MH HI2fI LA tHT$:ux D$`H=~$M1H %HN\H=}$M1H H,H|$hH=}$MH H<m|$`|$<H$tH$LD$ H=G}$1H VHIH$f.H5LL H57L H5"LH5L H5LH5LuH5Ld H5LH[I H$f.IסHD$hI 1D$tIwH=$4D$pI 蒡H$I 1uD$tlI 1\D$xSHl$H$HtKH6IG H S$HD$ HHH $H|$H $H$HHuHH={$MG H HHI1H5aa$H=z$M1H H|IsH$fUSHH_H9t8HH[H9t"H=|$uH%H[Hr|$H9uH[]ff.AUATUSHH_dH%(HD$1H9tlII@1HHLH5nH$a~HH$H{$H[I9t$H-{$HuH}H[H{$I9uHD$dH3%(u H[]A\A]ff.fUSHH_H9t8HH[H9t"H=W{$uHH[HB{$H9uH[]ff.ATUSH_H9tDHL%}H=z$t6H[H9t"LH u$H[H9u[]A\fDH5AH uH=aHz$HHHz$ff.@ATUSH_H9tMHL% H[H9t5H=7z$uLH u&H=~H[Hz$H9u[]A\DHHy$USHH_H9t>HH[H9t(y$uHߺ 1nH[y$H9uH[]vy$tÐKff.H=My$@AWL=KAVAUIATLL% USH(dH%(HD$1Lt$iHHtPHX IcL>HhH8jLiHHuHD$dH3%(H([]A\A]A^A_DH5A$HaJH55$HIJZx$uH.yfHcHSHkH9uTBf}&HE LHH$^$HD$8zf.HmH9H5,HH5:H{H5H}%HE LHH$$HD$8iH<$@H7@$IfH3H#HHHHhHH}H5m$H5xH}ZLELLL$L$$$HD$8jH=#t$L1H$c>fDH=s$IL1H'8H=s$LHp H5H H5Htl H5H F$H<$ H)@$pH=)s$LHuP$AH=r$LHE H#H$HtLHHE H #HD$fHHH $H|$H $H$HHuHH=qr$LE LHc H5~H` tM H5mHH uj$UL$H= r$L1HT/# L$H=q$L1HH=q$IL1H AWAVAUATUSHHdH%(H$1HD$ HT$ V D$8%=t6=@t7H$dH3%(H[]A\A]A^A_fDHH` 9HHtHD$E1HD$@Hx HH8tx.tLhL~HH=It€uHx :LL`ILLl$Mu@MM?MtILa xM>HMuL|$ HaL5Mt]M'HLd$t Iw1҉1 LMAExLD IHt/HLMMuH{f.D!U1SHHq$H(H{ HH€H=hH€uKH=oHHn.q$uHHbp$H[]fH5HHHH=HHtH5XHHHjH HUH=nHHmHnHHnH>HaH#H-#HCp$fDH#H9*p$WH5H=.#HH8H#H-#Ho$o$u =Do$uHHo$HDHo$no$uHHo$HDHo$>o$uHHjo$HDHYo$o$SHuHt#H%o$[n$uHYHn$HDHn$n$uH)n$HfDn$Ð~n$uHHb#HDHQ#AWAVAUATUSHXHWn$dH%(HD$H1Ht)fHC H;H2n$HHn$Huًm$uzHm$HZ1L%IL5m$!DL1LH Ht_L{LLH5LuH m$Hu @HHQ HuH HHHut\E11H<$tHD(HHD$HMM2H=c$H ̶HfDEx2LEH=c$H Mt2MMt*HU1HD$Ht1%Hk1AMMH=c$H )H1^ifAVAUL-_ATUSHHPdH%(HD$H1HH+LHt HLu MLH+LHuMMI6HtlH|u`StAFuiIH WHH=1b$1HT$HdH3%(HP[]A\A]A^MMuXHH{ :1H*OI1H=a$H ʴH2:H1I~ NLHH!I1Y@UH-t#SHcHt@@uBH#H<1yH1[]fDHA#H4H[]H=a#otfATUSHkH HHL%6KLHKHCH1HK(1H"HCHHKufDSHgH;H;H[ff.ATUHSHHtMHEHUH3C1҅yHÐHff.fATAUH-M$SfAH EuH ߻H1 H^Htz%@uVHGHtIHHH HH H@0 1 1^1Ht1Ho>tt2[H+M$]A\u 2f![1]A\f.AWAAVAAUATIUHSLHT$DL$dH%(H$1IHD$.?ED$HۉD$H$PHDEuAED$H/dev/md/CLkHHH=HH=,H H H|H9_ H<$H<$H HH9tHWHDQuHMII)HL$ MHL$ L1HPALL$ I1H=&I$H 7HnfHMH LD$$/LIH L{E <$MbA<$$|$< A: 2 MLֹMbL$H=L|$8H=MELIT$LLD1 A<$/ILHT$8L$L9tn:uiLT$ DT$HWLRL$A$H >EҾLLDº 1L豇LT$ u{tD{$LLHD$8CƃLfD< Ht< 1HL$8LaHD$8HD$LP0}HD$Lp MLLE11LL$H=ӱo?HtHHLH޿wH$ +HHHx*Ƅ D$X%=uLHt2H=y@$1IH H8LHL$,LHZDH fHLuD$$(@HHU`Ƅ$8fD:LHfLLHDLdLL|$8LHD$8CƃGf.HLEX8H=*?$IH 8IH1jDƄ$7fDH=H=rHD$H={P0Ru7HD$H=a@ I H=:pH={fHxdH]M|H\$ MH >HH=>$1lWIH HIH HۯIH HWMH ܐH_HMID$H==$H HïP1A[[wH=w=$H HѯPMMMf.AWAVAUATUSH(Ht$HT$HIID$ 1!DH #H9M?M/IGH#H9uH\$DHtL3MtMLIŃ~{HIcf.H~[ITDQu~IMlH=|Lu*IEAE1I$IH3AE-DHL3M\IGH #H9D$ Ht$E؉\$ HIM?EÉD$ MD$ H([ ]A\A]A^A_IH31"DWH([]A\A]A^A_ff.@ATIUHSHHu!@HHHtH{LAxt_HUL`HHEH[]A\f.AVI AUATIUHSH_HhI1HXMt;H#HtLH#HHCHt3HLHuIImIE[M.]A\A]A^fDH=LuNH-#HuL9%<$H-9tH=+:$M1H 7HnL%<$DH="LtH= LzH=LhWDAVAUIATIHUHSHLHcHuRA<=t []A\A]A^f ^I|IIEInI_IFIF[]A\MuA]A^[1]A\A]A^DUHSHHHvHxu 1HCH9EH[]ÐAWAVAUATUSHHH|$8H|$@Ht$`dH%(H$1H|$(H|$hHD$`HD$hHt$0H|$ Ht$0H|$ E1HD$@L|$(HD$HHD$PHD$XLHt$pH|$xH$H$D$PIcALyE)HIcLĀHLkMMT$AM9w2Ar*HLDD$LT$H $DD$LT$H $AM9\r4HHDD$DL$LT$H $\DL$DD$LT$H $A1M9w8r1LHHL$DD$DL$L$HL$DD$DL$L$D9M9wrHHu +D$D$HcD$HLpH\pHHHHH$HH$HD$pHHD$xHHD$`HtkHT$hHHT$8HH$dH3%(uQHĨ[]A\A]A^A_Ml$IcLI*DAMHD$hHT$8HHt\UHSHfH]Ht'HEH9Cr-wHHuHH]HuH[]fHHHEaff.HH=HH=HָtaH=#HָtAH=fHָt! H=VHIIHt&HGL x#L9r#I@L9sMMuE1DE1L9t$fDI@HtL9tMMtM9HuMuIxA9DBff.fUHSHH?HtH]HH{HuHH[]AWAVAUATUSHH $HfoH|$H$L$Ht$dH%(H$1)$HDŽ$h/HDŽ$HLXLIILMSLUH!%tD$ADHUHDHL)I)fDLHx uHXI|-LH5HT$ LxD$8%=`uHt$HD$HHH HH!HH H H H!H H9D$H[D$HߍHL$HXHcT$LIH4oWL$LIljL$H$LHcD$IHLH$dH3%(uH[]A\A]A^A_{ff.Ht HGH9w@HGH9sH?Hu1@H9HDAWAVIAUATUSHxL-4$Ht$dH%(HD$h1HD$XHD$XH$M9L=!#H-#H|$MH#DM6MHD$`IFL9H9uH|$H5#uI~Ht$HL$`H#tHD$`MnHD$ MtL1 @HHtH9XuHPHHuHE#HT$(HD$Lt$0fDH5 #H9MmMt/IEH;D$uIUHL$(Ht$H<$UMmMu@Lt$0M6MLt$MtmI>HteH#HtYH#H-#L$$fDHHHt3HpHt"HtHHLHHI>HuH<$H|$XHD$XH\$hdH3%(Hx[]A\A]A^A_fDI~HT$1Ht$#uIF8fDMnE1LMuHHtH9XuL`HHuH#Lt$MMIM6Mt?IvH#H9L9u Hh#H9uIVH<$LM6MuLt$PI}IEHHD$@IMHD$HLqL9t_LcLl$8MIIfDMmM9t7Ht$ K|%XuMLl$8IuHL$(LH<$'fLl$8Ld$ LnHT$HH|$@t-HIPLA-I|.I}Lr-,IE%=ff.fSHHH;[fATFH iUSHHDOPDGLdH%(H$1H$HHHBH-#H#HE/$u4H1ZHH$dH3 %(Hu>H[]A\DHsPH{LHHIHMtLU.ff.HHcdH%(H$1HHHH % ЉD$L@H @0 lj|$PHH$dH3 %(uHDH=.$AVAUATIUSH L-Ļ#PHXI\$IHhH@I9u!D6.$H[I9HLHuHH5`#HuHH5'#HuHH5#HuHH5#HuHH5Ϻ#HoH=+$IH $~H%[HfDH-$I[L5v-$]A\A]A^fDHa-$HR-$ff.fAVAUATUSHHPHt$(HT$0HL$8LD$@LL$HdH%(HD$1%O$IHXH@H$HD$HD$ HD$afDHD$U$L$Mtr/HЉ,$ L0NHIELLcHOHCHCI]/vHT$L"HBHD$MtHPHT$H9,$IEL-.,$HD$dH3%(uHP[]A\A]A^HD$ff.ATL%+$USMtZ@I$I\$H+$Ht-H{H+H{HtHH˽HuL辽L%+$MuHw+$[d+$]A\HtSfDHxHHu[fDS1Ƀt19[fAUAATE1UHSHHHHvtE1A9ADH+HHHuHD[]A\A]ff.@HAUIATIH#UHSHHFH9r&fDHEH9sHmHuH[]A\A]HH9tfDL9t HHtHEH9CuMt HCHuHsL'@HAWIAVIAUATL%#UHSHHVL9r-DIVL9sM6MuH[]A\A]A^A_AL9t$IVHtH9tM6Mt|M9fuvHuMtjI^ @M?MtXIH̿xuFHt-At'HH=|AAEEtE1f.1H[]A\A]A^A_ff.ATIUHSLHHH HtDH+HźHHu[]A\AVAUATUSHdH%(HD$1H$HLMtpIHIHfANLAVPLHH HL!H H HHH H!H MMuL4$H\$dH3%(LuH[]A\A]A^E1詻fHtSfDH訹HHu[fDATUSHH $HdH%(H$1IHH=y襹8HML1HHH5fHHt]CHDK@HK(DCH5|g袁fAWH51AVAUATUHSH(uE"uHBdH51ȆUMf uf} fD}$VMDkH51舆EHcH5L LH HHDL=LDL5LDL-HDL%|HDH1VH5&UXL[LXH=UYH5OL dHDLXLD@LD LDLDLDLDHDHD€HD@HD$HHD HD$HHHHDHDLDHL$LDH ωAWHDAVEAUHATHDL%ASARWVH5pft$Ht$Xt$hP1H`LE HEH5~f1҄ELH5fHEӿ1贄U1H5؉蝄}$NVMHL9bMULEH([H5Pf]A\1A]A^A_[f}HgkH=}mDDM DE H5ge1fDH=l}/f} ]8SHG0HN0HzH0L~9MtLMts@EEE9L ˈAULA,H=M#H ^:H_e1莅t@HP9@t\tXHLFH3L3@I HNLFH3HL3@I DF@EuDF(H@uH(A9u1@8É[@HP9HH9tMIM@1H=m#H ~9Hd躄[1HO0HF0[fDH]#NH]#N HP9@UAHH SH(dH%(HD$1HHHH&HHt# HH=v#aHHg#BHL$dH3 %(HuH([]{AWAVAUATUSHH $HdH%(H$1AH4HIHAIf.E1H[ HtdHtH{H3uH7$E~Hu͋LCH=#H 7H.c1H[ HuH$HuBfH(H[8Ht/C0wLHHm HuH[8HufDH$dH3%(Du[H[]A\A]A^A_LH)IBAE~H=#H 6H-b11Zzf.IIAGXHwpG$AHYGGPG`HpHH4H H9L\>L\9HyHH)H)HAu\At$II HH9uIAHxHHH@xH)1HAP~ GYGGPG`HpHH4H H9LL>LL9HyHH)H)HAP~ff.@t6x2HtEt`~.tA uGf1!1DuG@fGf1!G~ff1!ÀYHHt+H HtyXt HuHRHuHfHHfATUHSH?Ht vHEHDžH}Ht uHEHEPHt!H8HXuH}PuH]PHHuHHt%H{HtuLcHuLMuHHt}uHDž[]A\DHHE`GH}`HuH}pHtFDHHEpH}pHuH}xH0fHHExH}xHuSHHtH[tff.fSHH0Ht HC0[H@8p9v)HGP@Ht ;ptDH@Ht 9puH@HH=#A1H 2HT^}tff.fUSHHH0HPWUH=O#11sH[]A\A]@DT$0EAAEپHNH}H=#HNHH (HTP1@sAXAYH[]A\A]Mt AB H[]A\A]fDH=#AE1H 'HU1rTft$0H }'H~T6H=O#1rfDA $MDDމH bD$0H 'HTfDL$0H &H>Tff.ATAUHպSHHH ="1HDЉqHxSHDsiH=uD1Ap[]A\f.{hH=umpۉ[]A\@[hH=4TMpۉ[]A\@AUATAUHSH(Lo0DdH%(HD$1HtHL$dH3 %(H([]A\A]H|$,qÅt.H=#H %HS1pH\$1HHH@HHIUR@8tǃ,HHDKH߉D$ fD$ 'hAVAAUAATI USH dH%(HD$1Hf1LH]zHhEHDH5s1mAD$HJL RsL]uH HsH5ysLDʨLD¨HDʨH+sHE1KmAT$H5ds13mA\$ AT$H H L)H H31ҿH5BsHHHH1lHD$dH3%(u-H []A\A]A^DHH5r1l0gAWAVIAUATUSHFt1H[]A\A]A^A_Ð{AVLHIAFPHH HH!ʁH H HHH H!H 1HMt)LHtHsH'oHH[ HuHtHdAVLAFPHHH HH!ʁH H HHH H!H ]H=#H "IHP1mHd{IIHULEPMHHH HH!ʁH H HHH H!H 1UIfMtIwLmHuZM MuMMH !HaPH=#1lH[]A\A]A^A_f.L(cA A9uII9uMt,HHfDLbMpH 0!HaPkL aovDLUov+H=#H HgO13lIHBE#LH5E#L ff.@AWAVAUATUHSHy+HDžE1HDžHD[]A\A]A^A_ÉIָ ADžu1IIHtqHH@HD$H$HnE.H[HD9+uIvH{ fuL= HHDDSDAM?H=#M1H HOjM1AH=i#H zHKOjH$D9(#AMHAfH=nH5.oHEH=_mlIFHfnHHDQ L 1mH5nGVMH WH=#H-nP1RHNiH &H #H=DiH[HtH{H5_#HHDbH{uHH @#H=NAii@A~fH;tH$H$H@HuHt$LrH $HADHIB#L HmH=uH5mIvL*HH=B#H1 ~2fHC E1IH{(AF$IHBL9{0r$H[]A\A]A^A_1DDl$LKl=HH!WHk0H{(HL-aH{(H1GZD1e1Uy1nLcPL~MtnI$zXHH4HHpH<tHH|4EU9~)ЍC8H[]A\A] 0ofD뻐AVAAUATUSHHpHh0HHpDILhpx\LHçMt>A$AL$pH H HIH@H[]A\A]A^1@1H[]A\A]A^f.AWIAVAUMATUHcSHH(DD$DD$xXHPptHHD4HHEDd0Ls`HCXAH+HD$ADD$Dd$MtCIHuNfDHHt<xAN9HLuA~ 9xPuM6MuE1H(L[]A\A]A^A_Mt9AVLf.HHt9PLuAv 9pPtHHuAFHuAFt9D$tuD$uAV`Iv(H|$vfLHHD$HHE1}9DHA~@t:9HL2H9txI9uDPpHxpI I DnH|$E\HW1fDHBH9wI9r2HHHzHuH|$7E9D9uDE9AA9'DWYOu'u7H@utu1ff.@AWAVAUATUSHHHT$dH%(HD$81H$Lo0HHMAHt"FHH@HcHL EIHLHI@ADžI|$M4$&@L1LA9I$Dh$Le0H00foL@Hfg Sig. @4AHH@1.0.fxDImIIM9HtD@D83CDM$HH@HcHL M9,DK8E}H\$8dH3%(D1HH[]A\A]A^A_H=#H H&1/>I<$4L莿@AuXH|$0LL$ L$HMt3L\$HI!L >ADžHD$0I}HD$(=#H=T#H eH&1=I}3L3H|$(3f.LؾH H%H=#1?=E1LhLLxtտjIƋCHH4 LI4OHH;fHtA$AgHD$KDS@sL@@{M衚Ss@{I01҉LH1IILLHIt ItMgE1AG IpfEGXDK,AGPEAG`AEGZIU@KAWpH ASsDAƇ fAw|EG~AƇ AGHDŽ$ASDH HcH!HAGtH AA1LHAw|1H$1HAGxH At!QIIHH9uELE9fELfAG(HD$@PAG2AELAAFIEPIFMuP貾ODIEx1HtDHHu9}H VH'"@fI$IOHIITITLH)HI)HHH1I4H4HH9rH=ٛ#1E1H Hq!:H H"DAG2D{8AƇAWփAw~҃ DL|$(LL$ HLL05HL/L\$M}1LL$ LE_$L)K<2MuL$EG~fAW|fAHAGAƇHHDŽ$eHDŽ$%f.LE1%/L/HD$H=!#pP)H=B#H NIH 18L.L.H !H"  A$AATATATfATa0AWczt@SG<00oR@oZPf #foDf=~#p#1.0.DBPk#oJ0~#Hfg Sig. R#P#N#T#) #H# ӹ#ܹ##E>u*ι# #H H HH#H# #H#=Ÿ#1H@HH9uø#)Hz# #1fHH9u)z`H5Y#HӉ p#ku[Dj#Mk-86HDK DCPH=0#1H/H 8v6XZ[ff.fATUSHH $HdH%(H$1H}HtHƹH=r9t(H$dH3%(uCH[]A\@ILHtE12HLH59-AWfIAVAUAATIUSHHHdH%(HD$81H1)$H)D$)D$ fD$0"HH}2HfDLHH9t*t# ~LF:uH;LH9ufDH)IL9v L)MHHSHDHHDH1HH)DHDArdHEHHHHDHLHLH)A H)މHE1H\$8dH3%(DHH[]A\A]A^A_fAtEtD fD 2HDxAƅH=[8!fu2MqH=#M1H H3HHDE1&2ED D +f.AWAVAUATUSHH $HH $HH $H(H|$H=7IdH%(H$01+HøHH~1HH$ H-m6H $Ll$L$DLxHL3HtdLADžxU1LHtuZf.D8,H0HwHo,1H$0dH3 %(H(0[]A\A]A^A_@H4$D蔟HD$tIt]H$1D`uH$H56/bfH=>7)OH$H5<61x/H$H5861_/)AWAVAUATUSHH $H|$LdH%(H$1tD迷D$HH$dH3%(D$H H[]A\A]A^A_fHHD$XH Dl$LE L$L|$XL%3L4$H-AL- #@E1M MtlHtIH蛳uLHuAMwML MGH=#H1H[0M MufDt$HHt A H]#HD$(HHD$(x0H\$(H蓦{0HD$(HX(HH$H$H@H$HsH$8IHt׋H 2w H#H IT$H5`416-A$tuI|$>'HH H-HE1AH\$l"A9DOCT59 Ht-HtULxHH531L,t1HH53L+uD$lEuAHA-HuHDt$D(A@kID$HHD$ &L$DD$<HHD$0H=0H&HD$HH,HzH\$h1Ld$PH\$H\$dH\$Dl$@H|$v,H5HXHL$HT$1H5wH+uɋT$dD$hHHH HH!ʁH H HHH H!H 1HHkHt$ H{T$dD$hHL$HH HH!H H HHH H!H L;H"L$E1LLH558 1L ,IŃEE1LLH5]Ƅ$D$p^E1LLH51d$t |$pA H 8EJcH>fHHtH8HH[ HuD$HfA$raidAD$fLc|$DAD9l$DfH$D$|$@99 L|$ Ld$PMl$MAH\$hIo`Ld$(HD$HI\HHl$H\$HL|$ IH/IfM$$MI|$ HuHI9uLd$(H\$Lt$(IL|$ Ll$IIH\$AG8L|$Ld$L$$MM6MJI~ HuAFu"AD$8AFAT$8AVHAVHAEIHL9uLl$L|$ Lt$(Ld$I}IvID$AFLAEIGPIEH$MoP@9DH$dH3%(HĘ[]A\A]A^A_IH$HIG0fDI_pE1HHcHStIGpHuIW`AHI_`fIWPIt$HFfDH Ht(yXt"HtHFAPH A`AG8HRHuf.I_PMt$HAF;Cu9CH[HufMl$Au I|$I_PHE1D$L<$@H[HAu 9suH<$@-M|$IH@pA~XfAHcHT4M2IMIopIL$AHcH44L0HcHI6I7I|6I|7ILHI)DL)HHA}AW~H4$LHD$臛AMHD$xAO1AXtAHcHt4EU L;EHIEHfEW|1IFEHA1H1HIAGxH AHAGtH AuD^EuAyfID$HLIYD$@Il$DEED)D$D$Iw`HM EB<f.HcII E0A HH HAHAD HHfDHH;PuD;H uPx A9PHEJDPHDPpPHA9Ed@I\$sIGPHuH@H;puLVHhpIH'gHsLHHHLHEZtI E~1HCHA1HAJ|1HABxH AAG8fDMd$Ll$pf1H3%L)D$pIL$A\$Ƅ$}HEpƄ$HugHHP9puAt$LJmDID$PHEpHuf.HHp9p|+H$Mt$H9A9NyMl$MI}of.ID$H]0LupHD$DcfDA-DDH]ADAHyDp2E8AHyfLHNЃsZtAD$A~9t&1HkyHHAF99߃E8(fDID$HsHHILHLH)I)߃r1I<H<9rzAD$ATTcATfTQ@AW AVAUIH1ATUSH(M}0dH%(HD$1L<$M?HD$ظA9E1Hl$D8w;EH1ELIu|HnAE8w9wI}hH$HhPH@PHt9XumH@HEHuAo9u'H$HX`Ht@{|HHHuH$@81HL$dH3 %(H([]A\A]A^A_DH0H<$HEP9sPHhH@_fDDD$E1H=1W#H BH~t@{D|$LHDxfu1?jf.AWfAVAUATUSHL0H|$AGt0HtDAHtttHuHHtgqt_u uuxLʺOщD wHH@cuDED)@E1=3#DHw H"HfXHGpt*HcHT4t$t7t"1|HOHHEHff.HGHP$hhHH#HP(P4H$HH H HH#HP4P8HHH H HH#HP8Hff.HtG WH H HGH G 1GH G ff.AT1USH/DM8]HHEEt7@A8oB zHH H HFH H0F D9uE1}9Sptfh|H H HH#HptppH H HH#HpptVHHD4HPHH H HPH PPfh H H HH#HPE9AD9DH}HPHHXHH#HPP`ppPH H HH#HP`pPHp@t11ǀfh|f.1115fM$tuAI)IAAtdE1ADHI49I|9 FV D^ HL IHIWANfDAFE9AwʍAtHL1HHH9u+U U []A\f.AWAVAUATIUSH(L?t$EW@dH%(HD$1GXAG,D$ EuAG(AG@ID$`1D$Hu=QDHRoX0o`@ohPHHIZbj(HtHcPuHD$HuID$xHtDf.HcPo@0oH@oPPHRHHIBJR(HuAO8AIA91LLIihLHI;TAA~XHcH4HBptAHcHD4MtAxXtL fDEAG99uI$HtFt,Ag41I$hHA_$CtIT1LHH9uEL$A+_ A_ E'Et6ID$AHxHHǀHH)1H|$ vIl$`Lt$Hu<f.LVupL$t }`HmHDEExEHu}`Et1L"R\$ Ht$1ҋ}`H)H}`LVt8HDM`MDE P1H=ZF#H^_SAD$fT$1HL$dH3 %(H([]A\A]A^A_ E`It$}`H9D$ +H=DL}I\$`HfIl$XHHP{uI<$HH蟫uFD$tӋ{`xWuC`f.߉L2AO4mfDSH_0C8u[fDH1^C8[DAWAVAUATUSHxHo0dH%(HD$h1HUEfDH=lHGP4H``H H`$H ʋHHPH P4P8H H HPH P8@AVAUATUHSH@HPdH%(HD$81]HLm`IH\$Mt[fDAMxDA$t7A$%9tgAH9tB9MmMuAH\$8dH3%(D<H@[]A\A]A^fuEu`EEM EEHH 1 1H?AƅzE11HT$DDeXJHt$1DLL)HHuLD9u3E1tE.DS!H&AG8H 1HRIH=>#1AVA8}H HIUDAWAVAUATUSH(Lg0H|$I|$PdH%(H\$1A\$X[IH)IvpM|$`MHD$HH$@AOxX@tSAtGA%9@AH99M?MuLIbHøHtgIT$HyB0RH H Lt$HCHLI~hHLZL/ZIF`IFh1H\$dH3%(H([]A\A]A^A_f7A`H$1AGHt$A`1L)RHIt$A`L98tH H.IH=;#1QLM|$`M0LxH;18H yHrIAD$<LAIt$<@W[I1AT1USL'EL$8A\$HI$EEt;A8WB zHH H HFH H0F D9u1A|$9:f.xtf`|H H xpHPtH H H HH xptSHHD4HPHH H HPH PPf` H H HH PAD$99L|P`pPH`HXH H HHPPH P`Hp@t11ǀf`|5D111QfAT$$t\AI)MAAtK1@HI 1It1 A DQ DAHL HfHFBAA9ywBtIL1LfHH9uA+T$ AT$ []A\fDAWAVAUIATAUSHHnX1L$dH%(H$1HD$8HHD$CHt$8D-H9vbMt$H=n8#M1H zHAH$dH3%(D H[]A\A]A^A_H)1D[HAH|$0LLoHD$0LDHHD$_9Mt38VH=7#MH IH1H|$A?/f.M8MH iHIH=@7#1MM1AH=7#H HUHt$H=? 1HDuRULHDiH|$DG$H߉D$,EA!LCLLD$ LD$ Ht$H;LwH|$D$,1Dw$D!h H{H=)6#H :Hۼ1oH;HADMt!H=5#H H1*H|$AzjDMtH=5#M1H H DCH A$PtHTH(HH9uDI D)A9tAM8HH=-5#A1AUH 2HAh_AX{XL$LDL舝Ņx?ZHT$@DIHD$hHHHH  AVH 0 HS`AF D$IAEAF`H%Ls`IF LHHD$L$lAFLDIFh?MLYIF(H3H|$IV?Ht1oAF0oHAN@oP AFHAVPmAFH y9HL$E1E1E1DAHHT4HT$.XHT$HL9sMI)LHL$XLHI:?HL$HCPDiAHALHKPH A9A9}bHDuIA~XHH4HHpQHH9WIO@IkHL$E1HD$L{@$LL9L3Lc EfHWHHEAv$DH)LAAv<> NH AH9uHE1#L#AD$7AT$8t.I$HRHI(@H0H9uA|$9rDHQHPXHptHǀǀt%HHD4HtH@@AD$99|AFH0LVIF(SXH|$HL$ALlHI!L]Lt$8HL$LHLLK<>1L)\HL$H_L3Lk E1H8pAeDAUDHt$81DHIH)HHSH3DL)LHCL)H9urH DA$AA@tHTE1H@DHH9uDI E)E9Mt&RH=/#1AUH ׂH0Y^A[MA8+H=/#MH IH@1Mq8MH XHIH EH5H=ff.fAWEAVIAUATEUSHHH$Ht$dH %(HL$81)=HtoLl$AE H yLH1L/ŅHSX1;uyH߉$.Ng$u9HL$8dH3 %(HH[]A\A]A^A_uIHIEu‰$$HM롐H$HމB`1DHމƒuHD$HtH:Jt7A-1X1DHމƒ]AuϺ AWAVAUEATIԺAUH1SHHL$6sHIHI9t3E1L$oHD$D0$H[]A\A]A^A_fDI<H=AAEEuIH$Hu1HAHyKLDCPELH4$HtϸRDH[]A\A]A^A_ff.HWPHt#H:HtXt ]JuHRHu1DfAWAVIAUATUHSH8H_0H|$HCsMMuApHAxXHPptHHD4HHEIcHk`D0%HufDHmH;EuEHFHL$ IƋEQpIAFHEE~TAFLE AFXAFPIdžH H AIIAdžID$ApT=D$ CHMMAE9}~)M@AAE9}׋l$MB(HEHc|$ HIEH|$AHCHCHCHD3HS LfHH HHJTHǂHHhH@HuH@HD$HfLt$(ME1DApHLzHHHApMLDAHzHHHKCAdžIAVLl$ M!AWAVAUAATIUSH(HpHh0HL}`:?1LHHzb1ɉANl{XD$t {YZAAL$sX%@tH{Hdž<imsmƆ@H~HH{0HFF(džHdžHF@HFPFXHIIdžX,H$L$H^`x9DL8H1HI=\1ɉfET$XA$Iw`1DH9AHtAAD9FuANTuDIWxHu@HHtD;BuT$<t<uA|$~ ʃEtLF6t.H$9LA@9D9MIw`A$tHLSIO`HQPq@H H H)I$I$1AHAT$XAH ЉAD$XAHDAD$Xu Ix9tsH|$It$h8HD$Ht"\$~SHTfDHH9uH([]A\A]A^A_D1H([]A\A]A^A_AD$XokAD$hM1AW1AVAUATUSHHHo0dH%(H$1Ll$LDuHm`AHt H}(AD11j HmHuEx LHAŅ($tTH{0AfDAHHT4JDHDHAŅtH=2HS1H5諭AT$8H51蒭IT$P1H5zH$(dH3%(uH8[]A\A]ԧ@AWAVAUATUSHL0dH%(H$x1Ix9u+H$xdH3%(HĈ[]A\A]A^A_fLd$1HLL$:LLHIx9tH$01HD$H$5H$L0A_<1LHIZHT$LH:L $AINLH581AI@99謦ff.AT1UHSH0dH%(H$(1IH$L:HLH1HSH5輫H$(dH3%(u H0[]A\AWAVAUATUSHxHo0H|$H]Hu`HdH %(H$h1H\$ZKH$HHωD$,^H5Ƅ$H1HS1H5S@1H5S(1H5ͪS,1H5跪HKPHHL$8H H5v1苪1H5uxHD$x4 H=gǣLt$H\$@1HL :HLH$ IHHD$MIW1H5βHt$F$V D$(AtHHtH1HH9u)H9H H5޳HE1謩H\$MXH5߳C$ڍD!11~S81H5ijgS91H5óPHE`p@8s8v%| @ƋMXT$,H@HH;HHtCt H$ D$(HD$ HD$x9D|$(H|$E1DkOLt$ D}<1L|$HLLkpLyHT$LL:HE`{XDptHMd4 Hڿ1H5*EU<1H5/HD$H5HP1Su1ҀT1H5MAT$u1A|$TH5Ҳ1豧 gH51荧AT$H51t *1H5WE1BHzH HEH51ID9¿]踟M1H5,E1٦A|$te{XIc׿H5BH0HHD4HyADH0zHE1AwAD$A9|]" H51EEH51" ؞t>%A9fHA9A9H=A-UXH5.1觥LsI LuX1ҿHLHH5H1sM DStI I I LmuX1ҿHLHH5ްH1)SpMXH5ְH H 1H HH1CxH H H51ԤS|1H5f跤MtAT$ H51f蓤 IS1H5s1H5`{XSYyCH=[裝C~L%"H5I1{X 躜CZHUHMHDH51ѣH51辣S2H5߯1ifS(H51IHD$D$(L$(@99_HL$H]`E1A8LtILt$D|$,f.D9ctMXD8vDDL4H]`AF8AI0D9ADl$,Hu9fHHt({uMXH{0DD4HHuHH$hdH3%(Hx[]A\A]A^A_E1D{XLtHcID4HIDIcH qD3HqDHDH5_13H5X1ݡ0H=],H=uYoH=u'H5HADBI1WS`CPH5ڭH H 17{XtHI#t AH}H ZH5H1 覙H51̠ 肙1H5诠X1DVeupH=Wܙ71y1ҿH5H1A1H51,1>DH=脙H5k1H=TH= He[A\A]A^A_]DHEMLm1HEMua DIGEHIH HI HE0A 1 LFj M MA?uAIWuHE< IWHMELE|DM]ADEt]H}@H` 1H~HqH`H8H )"HHHHHE]HEHcUHH@HHBHH%H)HHH9tHH$H9ut H)HL I1L贖H}uEE1HEUHp`HHuHMIy(HL``;z(EpHI HHLa`;z(AH9uEHcEHMI Ǎ@EHMA8HuL}L1H0Huf8AMGMCMfDMv8M+LLSuAFA GƒEAFHuL(uEAF0HEI0P89tL}HEHHEHELmE1L}HpHEJHxH@`HEHX0HEHtMt$H=Z"M1H fH]PLFqfAUt,MtH="M1H H]SP봐H}Lm0'H:"HE8HEHHEFHfDAUIATUSHdH%(HD$1HOtGH=p"H H71OHL$dH3 %(H[]A\A]L$$11oOLIH=tLEfMm0I$LI}LIEI$HH)IH)΁HLmE11NLFH=t 0IM1Ҿ_19HFff.@H0HF@fFXFxmbrHHdž<mbrHdžFF F0FHPtHH9sHHH9ufATH5[1L%[U1SH_0HKKuHu[]A\fD DCL1wKDHH=Q"1H [H[M1HSHH0CHC0[DSHHtCH=[H€u.H "H@8HHHpH@0[@HhC1[@AWAVAUIATAUHSH(H0dH%(HD$1,CH|$@HE0LtLH=E"H VH41LHL$dH3 %(H([]A\A]A^A_ÐHT$ LDLt$ItM11D)LLDYFH=tAMt$H="M1H HRYKLKB`fDfAUtDMtM1H=Y"H jH#YKLAfAut$ 1DhKIDEH=7HEFI PARTI9mAP]1DDD$ A4McJILD*EI9H}Lu0\H"HE8HEHHE6BHW0fHF@FF F0FHFXdž<gptFxgptPHdžt;H(HH 1 fHHH9vHHH9uATH5eX1USLg0I$GA$H5RX1GA$PtM1H-Wf؉HHIL@(HH 1II)?GA9$Pw[]A\ATIUSHG0PI11=IIt$0HcH@H9uG1Ҿ_1B1[]A\f.HH9rHHHF@AVAUATUS@DEfD1AtFtDDL1E1D9uIESA91A@AD9uLoMtrAvlAFZMtM]ACF=tGtCED9tv1E1HEA9t[AoAEEH9uIM9u[]HA\A]A^1E1AHH9E[]A\A]A^E11A[LA(]A\A]DA^ff.AWAVAUATUSHhHL$0dH%(HD$X1HcF@Ht$<HHI@^fCf(HӍxHdLT$HA(HD$LH\$8E1E1HD$ HD$PD$HD$(fDDLMIHL|HtyLD$ HL$(LT$A A,Ll$LT$L\$tCD$LA,HT$PD$HLcl$HHMHIHBHHIGL|AE;(WH\$8HLLT$H 6=LT$HLL$0IcB@HIHH@`A1E1IGHI$@I9tSEtNHcHHH|tPI9H@DtH9vHIH)I91v!H9HBHQIfDHL)I91wH;HD$0AH8H;H|$XdH3<%(Lu6Hh[]A\A]A^A_HD$0AHIE1 =ff.HGH uH6SPDO@1DGH=D"DHDOGAȃfA w7Hs]HcH>fG@+nfD1ҿFG1@~CfDF@VDNEf11كu@G@uG@ | WZDO@u AtvȺVUUU)R9u At~A1A1ҿfDA1ҿA@pP1ҿ3f.1ҿf.HG@H HPfPDOD1DGCH=Z"AHff.G@OEDGCfЀv?DOGAEt Aft;u DL_AwLkZAKc L>fDDuAѸ AщF1DF@DNE1fDWDA GD<4<<`AGD<<0Ac@DE1HfDE11+@ODtXAE1ADA fzAE1A AA oE1bHH="1H HPNK?HÐATUSH_0HIH|5Hp5Hd5H@H@HEH}H@Ht75HEHtH8&5H5H@HuHPHt{fDHE}HPx98H}HHt4H4HPHuHXHt<HE}HXx7H}HHt4H4HXHuHw4ID$0[]A\fAUL-nATLgUH-i"SHH1HH X1HHH>L9t4DD <^vHLH1HHo>L9uEHH"[]A\A]@AVHcAUATIUSLw0HHHIHPfHH9Q8tM$H-MfDIPEELEMPHuHHD9@uD9H uHc@@HI@^fЃCftnRH=5"1AQHKEHAwtHt =tHu w HEff.HtdHHVDHH9tH8tH1J H@fDft)H HzH3H3~H u HNH9JtH@D9u׸ÐUIHISHxÃoLH@'I@HE1HHHtEHHt=HHI3I3IH uIIH9uHAHHHufEMPMt|E(ACH,II<(EtIHHt8HHNHI3II3H uIIH9NuHfHH9uMMufvHHIH@H1[]L>H HDIH=Ɗ"1)H[]HH H7DIAWDAVIAUATUSDH(dH%(HD$1u;HD$ HL$dH3 %(D$ H([]A\A]A^A_D/H|$ AIT$H(D$ tD$ @Ll$AGLIL|E1fDDL1HLAH{e!HC@FL9uO. ff.AWAVAUATUSHHL0Lf0dH%(HD$81MIGIWI3D$I3T$H t/D$H\$8dH3%(D$HH[]A\A]A^A_ID$I9GuI$ID$Z(9X(uDIM$@@ fAfDt$AffD$HD$(HD$MLd$MMl$DM@MxIL@HH\HHH3H3wH uHOH9uHxHt-AF8FtA0EI M?MkLd$l$MM$PH\$0AAMIPHt,A$ 9 u9 tHHuA(HH%KH H6H=_"1%D$fDIIIM9IPM$$MDE0H|$A EI$c%tH H5f@Hl$(ILLmHHE EHuI01f|$t@IH1H@ fH@9tHHHH3H3OH uHOH9Hu؉uI@"Hl$0Lf|$HHHEPIPEHUt5I ;JXt&H˜1H@9Jt A9uDI|$HE@tIA0H}H $tH H4fA0H}HIt$H xA(1M$LMMMI@HuIHHMHHI3I3H uIH9uLg0D$HF0yH="H H31"HND$C ff.AUATU1SH~LfA<$tH[]A\A]f=~Lo0HH~A0 H"Ņu=HsAT$EI0EHMtH{HCfDHC1kATIUHSHt!1H-ȉC C$ȃȉC$EuI$EB(ȃȉB([]A\ff.AWAVAUATUHSHH8L~dH%(HD$(1A=""""=t/=HD$(dH3%(H8[]A\A]A^A_Ð>uA`H_0Iw@5H uHG fftHWX1HBf.HH9k8tH@9uZfD>HLg0AGI$fq ff9AG_@HHHHpfD8HH9uAoo@1I$8HI$HH(AowPpAo`x Aooph0AfffAI$XH{HI$XI$PHI$PHEpHP@ǀ(HHu1DLg0AoED3A$0AA AA9M$@MIL@HmHHHH3H3WH uHGH9uHMDE1A$AEv5HEA$0A$LCJ IAWEAE9wI$F HffHF^HHtfH@H9uI$PHHD$H$HD$ HD$DHcU@DI$@E1E1HDA$, HL$HL$9tPHcE@HI$P^tfP^DHCHI$@`<DDAHHuHcU@I$A$(A9s/DD)HDHHLDHǀHH9uHLEHHHHA\Df$ffy\EtfI^MtHHD\HfD\HmHI$fz APE11+AI$qI@B f9B|tԉHHD^f% f= A9tDHHHHHHo oRPoZ X ob0`0I$PHcp@9uD@@HHuHfy\MfA\DffBD9v?DD)HFHLHHHI$HfvH@HrH9uI$8I$LY@I$PHp@9tIDM MxA9I@uA9eEHIHIIHo2A1ozAyor Aq oz0Ay0IHEH=i|"UIH vH+1ZY@@LsM/HCDILMHHD$IwI$MAFM$@AED1IFHT$Ή $HsH,@1L$htH=e"11H H1F@AWAAVIAUATUSLHdH%(H$1A8L$L$uAMI~0HtW$HىMDPATL$]XZH$dH3 %(HĘ[]A\A]A^A_fD11L'8Ht$1HD$11L1HL$xʉljD$vDD$1@DD$D$-DD$HD$D;Ht$Ht>uH<H=gDL$HT$0LDDL$0DL$@DfD9QMH HIH=c"11fH|$0LD$H$)D$@HD$pT$T$p)D$0)D$P)D$`D|$@l$LT$LD$=Mn0MPMGAMPD$MXLD@XH@`HHuHD$(D$IHD$HL$LLLt$(H$蓹HD$(H9wT$H9r D$IG`M?MuH HI;l$!IPH/HHfH?HHw`H9vH1fDH9p`HHu9HNf $WH=a"M11H H$D$7MH HIfDD$tHc1HHHHI$Hw,H eHVH=?a"113@XHO1DH9Y`rAXH H09'D$1EHH=`"A1UEH ҳH> AXAYD$HD$0DIF0OI~ HADL$DtI~0H 1sUfAWIAVAUATIUSHHHo0DvLHMH~H41HMH)T$ HHdžHLL$BL$T$ C AC A C(ABA@CDIPfHHAEv9HCLCXHHHc@HǃǃpHHǃ@`u@a<HshLDp2HH1MGH<H pHHǃH{xYMEEN1HAL9tHA 9K~LAA@ fftI1A;pX9tH@;ruHHHPATfuAHAL9uH[]A\A]A^A_ÉЙIMHL,9eHcIHHHIEH`HHHPH$A; u; HHuH~HLHHdžHH)HHLPGFF@fF FEFDdžtF HFLMdA ȉFHG fft+H1;OXueH@;Jt9uCTtIH CTHHD`H|@HH)HHH,GfBCXHHshLB(ȉHC`B,HǃCxC(HǃǃHǃ<ddfHǃiMHp fE1EV19~`fLHcAHA|XItaH@uQ9uIH= H=*HS1H5&$HE0H5HP1fH$(dH3%(u H0[]A\WAT1UHSH0dH%(H$(1IH$L:HLH=1HSH5 lH$(dH3%(u H0[]A\AW1AVAUATUSHHLw0dH%(H$1Hl$ HH:HH$ HHD$=If~ (H$`E1MHD$H$eMHD$DM}ELHHHHQfDHH98toHuhHD$$HAH$H$I$HJHT$HH߹:UL1Ht$8dH34%(HHH[]A\A]A^A_Am@LcLLbbIHtL1H=IHu,$@DExHAHHAT9H=D="11H LHXL8.IPHD$0E11E1HD$fIHuXfHHtJD9`TuyVHt:C@x$HcIHHL^Bu HHuEuIPAHuAE9epHrUTHL$,LD$0LAp;Ht0(`HxHHH1P9P9IHuBfHHt4x{9xLu{ 9xP HHuf.HHD\HSHHBEHL$HLIHD$0HD$HD$0I9`KHT$D`HHLK HID`THHʼnHP@XHǀHGDSJ BffIcpHB 1HHL\ @HIDHHHH3H3NH uHNH9HDH L9uԅHD$0EA0 Hc^Ht$HCHCHHHt$0HCHS A0H HD$0EvLE1AfA0H@DA J40IH{HD$0ED9w@LcHE0MPfDFT1DNLDvPDA LML HHtpD9HuD9p uHc@@x\HIE,@XHHHJHHHlHD$HHH=8"1H AVHH)H1ZYu~(A<$\SLL H8DH9uLAEfDAUATUSHndH%(HD$1kHIH1LBCH$H{HHHH H)H$HHHH)΁IUHIT$8H+HSxIT$(H5ID$0HS`H>HCh1LHH-HHȉC,HH)HIuHH)HHH)΁HHHH)H HIMHHHCpHC0C(tHLC葙HLyu}D1H|$dH3<%(H[]A\A]HHHSxIT$(HH-HHC`ID$0HH$H-HH4$1҉H H@HމHH?W`AUATUSHHPHt:I1E1fHLAHHu1A9H[]A\A]@H1[]A\A]H08uDLJ8yfAVAUATUSH_0LHHǃHMMHHLLAă.H}hYHHHx H@HH@x)1H1HfFAoF@IFF`HFPR1[]A\A]A^f.HHH81蓰H}08tLJ8V[1]A\A]A^H=4"H %HM1ZH=3"A1H H,OLH=3"H IH<1Dff.AWAVAUATIUSHH_0HhLHHǃHZMu=HXHtHpPQHXH@PH1[]A\A]A^A_WHAwoHHHfoJHoR P oZ0HHX0o"`@ojhPor p`oz0fxLxpQ0AE HcD$ (WIIHcHLH$\AEv7A1DIGDH$ALH4H*AEC9wӋT$ LL|PMtI|$0H[]A\A]A^A_HPHtٽH{11A*tHHuDAUATUSHHo0dH%(H$1HAH1D<HP HT$D7D$(%=`HD$8HPIHIIH I AE0A A HufDHHD9CuD9K uDkDcHHDk,fDH=y0"H H1H$dH3 %(Hĸ[]A\A]DH@H|$uHl$1@1HHH$DH3HDHHdfDH=/"H ‚H13AWIAVAAUATUՉSH(pdH%(HD$1HHL$ LD$L`0L/HtZIHt ID;qTu kD9qTtbHHuH=."E1H H^:f.HD$dH3%(H([]A\A]A^A_DI$PDILQPHHHxD9Hu9P uM$DT$ Aq CfDft'I1A;QXu~DH@;WtwD9uHt$LNI$HH|` 9 H ˆT`I$8I$L1D9p@uHcHHLJ^@tfB^tHfAD1^f9u]Y@HcP@I HICHIA$,HIID AA\fAA\Ht$LOI$HH|` 9DHH=,"E1RH HIXZ+ff.AWAVAUATUSHhLg0H4$HT$dH%(HD$X1MM$HAF fDHcfIFXHD$IAEHIfIGf.HI9t!8tIwH1A…I@I9uHT$In@1fAHHH9#8tHH@H@A9wH ~HH=x+"1E1H|$XdH3<%(D> Hh[]A\A]A^A_H`H|$ MžA…tH 0~HH\$ LH<$HH]0HtH{Ld$@D$肔C(1H01.02.00HC fvCpH-)C@H@H@ȉC,HHHC4CtA $H="H1H!%tDHqHDΉ@HH)H )tD H~ޭo 8L@H H~L(H8HHMtLD$D$H=H|$(D$D$2H=K'"1D$H QzHD$@HD$@H~HHILHLH)2I)1ɉ΃M4L79rf>IFXHD$DH=&"I1D$H yHD$HD$HDD$Ht$Lx@H$Ht$DL$H HDL$IIIt$L$|$MLL$ffC|.X1fAAZN'LL$1fDD$fAA\H$fCT.^H@,AA`HAAaKD.bOl.pHPfP AEt%HDD$膽HLHc訿DD$H|$8DD$I$BfffBA$0 HD$tH [xH4Ll$8DD$1IEEIIEADžoUAHEIBH<$fvH-M8WDA ADž$ҍA(I ADAB[~DT$A@fA;$,AƅFAEIuI$0DT$誙DT$O?LHIHH$HDP@pxr fvMXIAHHϾAAA)A)A)A)A)A)A) A)0A)@A)PA)`A)pA)A)A)A)A)A)IPM`MhMpMxfEEEE1IDžAƅA)A)A$,z1HA$,H<]AEAIEA$0HJ<0 荼IEJ0I@hFAE9rI$@I$8I$1IEM$@M$H{AHL$(ǃ IHH衹fvHH@H@@@""""H@@@@DfvL`H@)@H9uH|$0@tbH tHDT$HH=h!"H\$H otHCPDK@1DC蝿L^_DT$HL$0@1ǃ$@HH贸fvHH@@@H@@@@D`DfvH@)@)@)@)@H9uH]0H8H1A&HPLLD$H=k "1D$H qsH2譾LD$A $AD DAD fD蟶ff.@AWAAVAUATIUSHHo0H $HHdH%(H$1HIcL$ HPH<AD$DHH$9CuA|$9{ uS@ AD$EALv,@f9r1PHFL<Љ1AIGHHHD$(HFHt HHD$(HL$(LHHDL$ uHAT$ (Hȉ4 C,IIItCHDL$ <H1DHHz9uf.E1H$dH3<%(DqH[]A\A]A^A_ÐHT$0DIDL$ &HB fftI}hHXILXFHu9fHH$;KXuH lHLH xlH1HHHExDKH$HtHCDfHHILDh`^LH8HAA El$`HcC@HHP\fP\LE1cHBfffBHH9HEN EF1QH=~"H kHƶ^_[HHHHI^(HIF8HIF0IF0HIN8HI^(HHIF8^HPH8H1ILP/}HH]f.H#EgHGHHܺvT2HGHGff.@HʉWʉVWʉVW ʉV WʉVfAWAVAUATUSHHKDC H|$0DKHT$XdH%(H$1HHH{HD$PRKH9sCHL$PH9L$0H\$pDL$HADD$DT$bʉ$D1D1D3D$A1D1D1É+bʉ$\$LD1AȉD$ L$H1H@H3~1H@H3~1H@H3~1H@H3~1H@H3~1H@H3~1H@H3~1H@H3L9dt7H CH|fDHV1HH3H9uD1DHf.AWAVAUATUSHdH%(H$1HcLt$HD$HD$LDAAIHl$  ?)GD$HcIHD$ @HcLD~>HcI)tdH1HH|$ԓ|$11MHL | \H$dH34%(uHĸ[]A\A]A^A_fD1ff.@AWAVAUATUSHdH%(H$1HcLt$HD$HD$LDAAIHl$  ?)GD$HcIHD$ @HcLDz~>HcI)tdH1HH|$贒|$11MHL | <H$dH34%(uHĸ[]A\A]A^A_fD1ff.@ATIUպSHdH%(HD$1H5D$t0H5kHL$dH3 %(u>H[]A\fHt$=T$~uIt$A$HAUIATUպSHdH%(HD$1IL<$ZZHt$Hc|$@}PIELxS<$ZZuJD$AE1HL$dH3 %(u@H[]A\A]DT$IEHOyI}CH8fdH%(HD$(1H)$)D$HD$ HL$(dH3 %(uH8ff.HHdH%(HD$81Ht$|uT$HL$8dH3 %(uHHH|$D$ 躍D$ ff.@ATLHIH )UdSHdH%(H$1Hl$pHA$<-I/LUHL)H} LHHpH1]C HkHfP1.soc腗ÅIlHI|$f$͓nLxg1Ҿ1躍߀Hc1覍H$dH3 %(u讂8'H=!MH @IHB1߻dLH=A!H R@H艋߃/i襃DAW AVAUATAUSH8|$H|$ dH%(HD$(1UtQH=!1E1H ?H" DH\$(dH3%(L/H8[]A\A]A^A_fLl$ ߺ LHÉD$L$IxfAoEfAoMHfAoU P fAo]0X0fAoe@`@fAomPhPfAou`p`fAo}pxpfAofAofAofAofAofAofAofAoEPH@(1HD$HGAv4H 1H|HHHHD$H9Dd$Lt$E1AIfDD)L9IGMJI1E1DCAA@AAʃA AAʃAAAʃAAAʃAAAʃAAID9OHcA< )ȃH HcH>fHD$1L~HD$IIMD  DEHcIHI9 LDI M)E1ɉ…]Lt$H=a!H r<H{MF(襇L|$&11Af1DAbitmtBH=!H ,:H}1aH=!1H :H@SH521ڂDCA@HSLCHD$MHI H HEHDE2H51{D^H S4Hf<HD$HHL$(H D<HL$0IH A<HL$8I H =<HD$ HL$@O1ILʃH uHHD HPLH="1yzYH"^H5z1轁S81H5见DCSDE1EuYHHfH*HYHtfH*^H5dE1Ҁ|HsyAH$dH3 %(DHĨ[]A\A]A^A_fDLd$PH I@1L訃ЈT$H5yAAȈD$T$D$T$1!{DHSH5n1HS 1H5is0H=! HH5[HHDH1HHDIAbitmt!H=,!H =6HF1rDH5c1 HS1H5]~HS 1H5_~s0H=!H H5QHHDH1~EuVHHfH*HYHt fH*^H5߭P~AE9eD~LHD$HvH<$DLŅDH5Э1~AE9eDE1yHv)HHfHH H*X2H=!H 4Hc1AH=z!1H 4HmHHfHH H*XDH5&1*}DHHfHH H*XHHfHH H*XICwAW1ҹAVAUIATUSH(dH%(HD$1Lt$HD$L^H|$"u1AHH@D1E1A2D1HHt8bitmuoHEE9hD~sHD$HtLLH|$tyAHL$dH3 %(DuEH([]A\A]A^A_HXtwE1@HT$wHT$H/tuAWIAVMAUIATIUSH(LL$H$`dH%(H$1u |H5#OLxHH3DICLD$1D$bitmMHLH$hD$Mt AoED$D$t$DHٺLDt$HD$LHl$8|H H 1ID/IHHIu:H1`tH$dH3%(H([]A\A]A^A_DL$HŹ@HLHHٺL+|HHHHxH5xIyŅ-HsPH3fDL<H HLH9rDDr8{MH j0HIH=A!1{H8sLPrH=!MH 0HpQ{@r8|{MH /HI{q8O{H=!MH /IH,1z3H=1yHzrDAmrff.AUA1ATUH1SHdH%(H$1[zHt6H$dH3 %(H[]A\A]f.ILNtH=u<$bitmuHI|$D11yHuLiq11H=uy1^yMqfSFvHt[H5@.HHHHHPp'H5Hp؃ySvHt[H5-HHHHHPp'H5RHp؃xSvsHt[H5-HHHHHP;p'H5H"p؃CxSxHt[H5 -HHHHHPo'H5Ho؃wHHtHUHSHHxHX HtVnH}MnH]HHuH[]f.ff.@UHSHH "HuYfHHC8Hu@oEoMHU P U$H@(fP$H@8HC8H[]ÿ@oUo]HZ "XU P U$H@(fP$H@8H[]fATUSH_(Ht@f;3u2Hf9t"HCHu%f(H@HC[]A\If(H@ID$([]A\ff.@UHAVAUIATISHHdH%(HE1oLIoHIDHH%H)HHH9tHH$H9uurIMH ;HH1v1H1sÅxHL/AioHMdH3 %(Du*He[A\A]A^]f.H)HLAmHBH9r1fzu)L|"JMt,I@(Hu H@Htf;u1M@8MuH)~HD?$VERt HH9uUSHH'{ Hv;Cft2H3ftf.HH3fuH1[]sHDAWAVAUATUSHH $HdH%(H$1IH=٤H!lIHtzHrHtbHL-¦fLxH1MLuHHoHtH lIvHHjtGL/rHuLE1mH$dH3 %(LuMH[]A\A]A^A_MHH "ttL|mHHoIkAWAVAUATUSHH $HLH|$H\$`AIHt$HDHDA%IdH%(H$1HH8PHH0PHH(PHH PPHHPŹ%PHH0AVPHH8PHH PHH(PAUPHкHP1hH쀾1H$St$LHL h_11AXH7pHމljD$hH-H|$cHD$XHt AWHD$PH$x dH3 %(iHĈ []A\A]A^A_f1H&eLl$XHD$0MtbLd$@H\$8HLIDIfDMeL\aHLH.`Mm DMuLH\$8Ld$@ALIH|$0E1h_1HdHL$XHD$0HpH\$8HLd$@IHl$HDMl$L`HLH_Md$ DMuAH\$8Ld$@Hl$HAH|$0^@HL$HHA HD$P@H5ޘH=W(HD$XfDHD$XHXH|$X1GdHD$HD$PH5H=HD$XHMHSLL$H hXZH|$PDyH|$aHD$XHE1H=!I1H HGgJm_ff.fAUATUSHH $HdH%(H$1HHIVHA̺HEL+!]XHZHDq Åu+H$dH3 %(uFH[]A\A]EtH=!I1H +H×bf^ff.U1SH?bH H;!H=!t H=!H5ciH=H5KiH= HH5?iH=HHH tHHuoHH\Ht_H߾ZZH߹H)H5Ғ`H11^Åx$ǹH_Ht0;ZH$dH3 %(uH[]fD Z1XfUfSHHHdH%(HD$811H|$ D$fD$0H~ 0D$,D$$VMDHD$"D$*$D$2uDŋD$ H|$ҍTfT$ fD$fT$HHL$8dH3 %(uHH[]Wff.@?uWSHH=,!HtsNH!@0[fDHH=!u H=!@1[@1ff.fUSHH!OHt7HP(Hu#HRHtf; uHHH[]DH@8HuɃ?HHHuσ}H=}萲H=D|uH=GluH=3!tH=YMHHH U7 H= 6 H '!UH+HA(HuLH@HtLE1QH=!H  IH1QV@Dd$ L;PfDH=ɷ!H H1VDA+Nff.SHH $H1dH%(H$1HHHt>$H=*HH$dH3%(uH[@1Mf.DR!ÐHHdH%(H$81H$H<$HDŽ$bLH$tHH$8dH3 %(HuHH Mff.S1t=Φ!xeN!H=!Ht$RH!H=r!HtDH_ JHHu[DHt HSH=6!(PH!HH%H H=HPH@H@H@ HtW1H=1QÅxAA A1CPHĥ!Ht!1[@AM[Df.v!xzUSHHE!HtXH HHuKH[ Ht?H Ht7H@!HSHsHHH0ՅtH[]H1[]1D5!AWAVAUATUSHH!H=Ҥ!L%!L-!HD !H9v;I=DE1HD*fAUtPLL1H9wE&H{!MAILL!H9HCIEtR"!QEqH=,! H$!MLIL!AH9HCIfUH9I@LH9 !IfUuO tHcLI9wHH1H@rH9u@uWHHIHHXIXHXL!H@ LH9rH[]A\A]A^A_Lc1LH@rH9u@JTH!f!fH1HJH9uHf1H(T$ L$KHAT$ L$IG A9!HU!M !IL"DLL9t/HV1ǁ EljƒuL9uÐLL9t/HV1ǁx;EljƒuL9uÐLL9t5HV1fDǁHljƒuL9uf.AWIAVIAUAATL%(!UH-(!SL)H:Ht1LLDAHH9uH[]A\A]A^A_ff.f.H'!1MHH%s: --%s option duplicated! /run/mdadm%s/%s.pid%s/%s.sock%s: %s: %s %s: failed to create pipe %s: failed to fork: %s %s: %s already managed /proc/%lu/cmdline@dmontakeoverforegroundoffroothelpthaF/proc/mdstatexternal:1.x0.90%s: failed to load sysfs info for %s %s: %s is not a container - cannot monitor %s: %s does not use external metadata - cannot monitor %s: %s uses unsupported metadata: %s %s: Cannot load metadata for %s %s: failed to notify our parent: %d %s: failed to start monitor process: %s Usage: mdmon [options] CONTAINER Options are: --help -h : This message --all -a : All devices --foreground -F : Run in foreground (do not fork) --takeover -t : Takeover container %s: %s is not a valid md device name initrd/mdmonnonewrite_mostly-external_bbl%llu %d%c%nexternal:-reshape_position-blockedremove+in_syncresyncrecovercheckrepairclearinactivesuspendedreadonlyread-autowrite-pendingactive-idlebrokenrecovery_startunacknowledged_bad_blockssync_action0.%03ld frozenarray_sizelineararray_stateresync_startsync_completedsafe_mode_delay%s: failed to monitor %s :. -pollutil.cdevname && pref0123456789%02x size=%lluK mtime=%sReIsErFsReIsEr2Fs size = %lluK %s: fstat failed for %s: %s %s: stat failed for %s: %s (y/n) %s: assuming 'no' /d/md_d (%ld.%02ld MiB %ld.%02ld MB) (%ld.%02ld GiB %ld.%02ld GB) (%ld.%02ld TiB %ld.%02ld TB)%ld.%02ldMiB%ld.%02ldGiB%ld.%02ldTiB%ld.%02ldMB%ld.%02ldGB%ld.%02ldTB,far%s near=%d%s %s=%dNO REDUNDANCY/sys/block/%s/dev%d:%d /dev//dev/%s/dev/.tmp.md/dev/.tmp.md.%d:%d:%d/tmp/.tmp.md.%d:%d:%d-no-metadata-%d.%d-unknown-/sys/dev/block/%d:%d/holders/%s/md/metadata_versionexternal%s: %s is not a container /dev/urandom/dev/null/proc/self/fd..%s@%s%s.service/usr/bin/systemctlMDADM_NO_SYSTEMCTLinitrd-/etc/initrd-release/sbin/mdmon./mdmonMDADM_NO_MDMON/proc/self/exelibcmap.so.4cmap_initializecmap_get_stringcmap_finalizetotem.cluster_namelibdlm_lt.so.3dlm_open_lockspacedlm_create_lockspacedlm_release_lockspacedlm_ls_lockdlm_ls_unlock_waitdlm_ls_get_fddlm_dispatch/dev/zero%s: Cannot open /dev/zero %s: Mapping /dev/zero failed nsec < MSEC_TO_NSEC(1000)bitmap%s%s: failed to lock cluster %s: timeout waiting for %s %s: error %d happened when unlock %s: error %d happened in ast when unlock lockspace %s: error %d happened when release lockspace %s: %s appears to contain an ext2fs file system %s: %s appears to contain a reiserfs file system %s: %s is not a block device. %s: %s appears to be part of a raid array: level=%s devices=%d ctime=%s%s: partition table exists on %s %s: Cannot get size of %s: %s %s: Cannot get sector size of %s: %s %s: partition table exists on %s but will be lost or meaningless after creating array %s: metadata will over-write last partition on %s. %s: array size is too small to cover all partitions on %s. %s: Couldn't open %s, aborting %s: Failed to determine device number for %s %s: Failed to read sysfs for %s %s: Operation not supported for %s metadata %s: Failed to allocate device name %s: Failed to load metadata for %s %s: Failed to find subarray-%s in %s %s: Cannot open /proc/self/fd directory. %s: cannot run mdmon. Array remains readonly %s: failed to launch mdmon. Array remains readonly %s: Failed to seek offset for zeroing %s: Zeroing disk range failed %s: Error sleeping for %us %ldns: %s %s: Something wrong with dlm library %s: The md can't get cluster name %s: %s failed to create lockspace %s: open existed %s lockspace %s: error %d when get PW mode on lock %s ԉԉԉȉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԉԌԌ,hppxPsleep_for/dev/md_dis_devname_numberedmaps.cretno-pplno-bitmapsparc2.2super-minorsummariesuuidhomehosthome-clusternodesdevicesizeforce-no-bblrevert-reshapelayout-originallayout-alternatelayout-unspecifiedbyteorderunknownwrite-transientwtread-transientwrite-persistentwpread-persistentrpwrite-allwaread-fixablerfflushdefaultassemblecreatemanagemiscmonitorgrowincrementalauto-detectstripemirrorraid4multipathraid6dangerousleft-asymmetricright-asymmetricleft-symmetricright-symmetriclaralsparity-firstparity-lastddf-zero-restartddf-N-restartddf-N-continueleft-asymmetric-6right-asymmetric-6left-symmetric-6right-symmetric-6parity-first-6map_num_sPersonalitiesread_aheadunusedbitmap:superrecovery=DELAYED=REMOTE=PENDING/sys/block/%s/md/dev-%s/sys/block/%s/mddev-offline/sys/block/%s/md/%s/%s%lli/sys/block/%s/uevent%ld.%03ld levelraid_diskschunk_sizelayoutcomponent_sizeconsistency_policynew_devppl_sectorppl_sizeinsync%llu %d %d:%d:%d:%dfrozen idle recover name=uuid=%s: Invalid uuid: %s /sys/block/%s/md/component_size%s: This kernel does not support external metadata. %s: This kernel does not have the md/array_size attribute, the array may be larger than expected %s: This kernel does not support PPL. Falling back to consistency-policy=resync. %s: The kernel has no support for bad blocks in external metadata /sys/dev/block/%d:%d/device/scsi_device%s: SYSFS: failed to write '%s' to '%s' %s: Only give one device per SYSFS line: %s %s: %s is an invalid name for an md device - ignored. %s: Only give one uuid per SYSFS line: %s %s: Cannot parse "%s" - ignoring. %s: Device name not found in sysfs config entry - ignoring. metadata_versionstripe_cache_sizsafe_mode_delaybitmap/locationconsistency_poliblock/device/sta%s: Value "%s" cannot be set as %s. Reason: %s. %s: Value "%s" cannot be set as %s. Reason: %s. Value ignored. Special keyword is invalid in this context%s: cannot open /proc/partitions %s: %s arg of "%s" unrecognised: use no,yes,md,mdp,part optionally followed by a number. %s: unreconised word on DEVICE line: %s %s: only specify uuid once, %s ignored. %s: only specify super-minor once, %s ignored. %s: invalid super-minor number: %s %s: only specify bitmap file once. %s ignored %s: only specify devices once (use a comma separated list). %s ignored %s: only specify one spare group per array. %s ignored. %s: metadata format %s unknown, ignored. %s: unrecognised word on ARRAY line: %s %s: ARRAY line %s has no identity information. %s: CREATE group %s not found %s: unrecognised CREATE mode %s %s: metadata format %s unknown, ignoring %s: unrecognised word on CREATE line: %s %s: Not a listed device for %s. %s: Different super-minor to %s. %s: %s doesn't have any identifying information. %s: we match both %s and %s - cannot decide which to use. %s: multiple lines in mdadm.conf match %s: Device %s given twice in config file MDADM_CONF_AUTO 1.%s %smdadm.hret >= 0config.cidentdevnameAlready definedNot POSIX compatibleInvalid lengthToo long or empty/proc/partitionsmdpcontainers%s: bad uuid: %s super-minor=bitmap=spare-group=level=disks=num-devices=spares=metadata=auto=auto typemember=container=owner=%s: missing owner name %s: CREATE user %s not found %s: missing group name mode=%s: missing CREATE mode names=yesnames=nobbl=nobbl=yes%s: Unknown keyword %s .conf%s: UUID differs from %s. %s: Devices %s and %s have the same name: %s mailaddrmailfromprogramhomeclusterpart-policysysfsmonitordelay@0P0 xasprintf_ident_set_name/dev/md__ident_set_devnameident_init%s %08x:%08x:%08x:%08x _any/dev/md/%s%s%d/dev/md/%s %s %s %x:%x:%x:%x %200s/run/mdadm/map/run/mdadm/map.new/run/mdadm/map.lockmknodchownchmodmodprobe md_mod%s: error opening %s: %s md_d%dmd%dmd%s%dmd_%s%s: %s is already in use. %s: failed to create %s chown /dev/mdchmod /dev/md%s: %s exists - ignoring %s: failed to create %s: %s %s: Fail to create %s when using %s, fallback to creation via node %s: %s does not appear to be an md device %s: %s is an invalid name for an md device. Try /dev/md/%s %s: %s is an invalid name for an md device. %s: %s is an invalid name for an md device (empty!). %s: %s is not allowed for a %s container. Consider /dev/md%d. %s: No avail md devices - aborting %s: %s exists but looks wrong, please fix %s: unexpected failure opening %s /sys/module/md_mod/parameters/new_array-part1.01.11.2includere-addspare-same-slotforce-spare/run/mdadm/failed-slots/run/mdadm/failed-slots/%s%20s %08x:%08x:%08x:%08x %20s %x:%x:%x:%x .temp%s: metadata=%s unrecognised - ignoring rule /sys/dev/block/%d:%d/partition%s: policy rule %s unrecognised and ignored %s: can't create file to save path to old disk: %s %s: Failed to write to cookie ACTION=="add", SUBSYSTEM=="block", ENV{DEVTYPE}=="%s", ENV{ID_PATH}=="%s", RUN+="/sbin/mdadm --incremental $env{DEVNAME}" ACTION=="add", SUBSYSTEM=="block", ENV{ID_PATH}=="%s", RUN+="/sbin/mdadm --incremental $env{DEVNAME}" /dev/disk/by-pat/dev/./lib.cstr/sys/dev/block/%d:%d/dev/.auto-read-only)/proc/devicesBlockdevices:bufs_gethostnameis_name_posix_compatibleis_string_lq(auto-read-only)/dev/.udevMDADM_NO_UDEV/run/udev%s: No udev. %s: Cannot initialize udev. /run/mdadm/creating-%s%s: Cannot initialize udev monitor. %s: Cannot add udev monitor event filter for md devices. %s: Cannot enable receiving udev events through udev monitor. %s: Cannot access file descriptor associated with udev monitor. %s: Cannot block udev, error creating blocking file. %s: Couldn't open %s for write - not zeroing %s: Unrecognised md component device - %s %s: Could not zero superblock on %s %s: Subarray-%s still active, aborting %s: Failed to delete subarray-%s from %s %s: Deleted subarray-%s from %s, UUIDs may have changed %s: superblock zeroed anyway Valid --update options for update-subarray are: Valid --update options are: '%s', detailexaminefollowzero-superblockqueryexamine-bitmapdetail-platformkill-subarrayupdate-subarrayudev-rulesexamine-badblocksdumprestorehelp-optionsverbosequietroundingparityraid-disksraid-devicesspare-disksspare-devicesassume-cleanwrite-zeroesbitmap-chunkwrite-behindwrite-mostlynofailfastdata-offsetwrite-journalconsistency-policyscanforceupdatefreeze-reshapeadd-spareadd-journalfailset-faultyreplacewithrunstopreadwriteno-degradedwait-cleancluster-confirmbriefno-devicesexporttestprefermailalertincrementdaemonisedaemonizeoneshotpid-filesyslogno-sharingbackup-fileinvalid-backuparray-sizerebuild-map%s: (IMSM): Unsupported attributes : %x IMSM_SUPPORTED_RAID_LEVELS=%s%s%s%s%s IMSM_SUPPORTED_CHUNK_SIZES=%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s IMSM_MAX_VOLUMES_PER_ARRAY=%d IMSM_MAX_VOLUMES_PER_CONTROLLER=%d %s: %s doesn't appear to be part of a raid array No bad-blocks list configured on %s Version : %d.%d.%d.%d Chunk Sizes :%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 2TB volumes :%s supported 2TB disks :%s supported Max Volumes : %d per array, %d per %s %s: HBAs of devices do not match %s != %s %s: IMSM_DETAIL_PLATFORM_ERROR=NO_INTEL_DEVICES %s: IMSM_DETAIL_PLATFORM_ERROR=NO_IMSM_CAPABLE_DEVICE_UNDER_%s %s: cannot find imsm_dev with index %u in intel_super %s: imsm: Name "%s" is too long %s: imsm: Name "%s" already exists %s: Invalid file descriptor for %s %s: platform supports a maximum of %d disks per array %s: platform does not support raid%d with %d disk%s %s: platform does not support a chunk size of: %d %s: imsm raid 5 only supports the left-asymmetric layout %s: imsm raid 10 only supports the n2 layout %s: imsm unknown layout %#x for this raid level %d %s: platform does not support a volume size over 2TB Failed to seek to PPL header location%s: Failed to allocate PPL header buffer %s: WARNING - Cannot detect HBA for device %s! %s: WARNING - HBAs of devices do not match %s != %s %s: WARNING - IMSM container assembled with disks under different HBAs! This operation is not supported and can lead to data loss. %s: WARNING - IMSM container assembled with disks under HBAs without IMSM platform support! This operation is not supported and can lead to data loss. %s: imsm: %s is a partition, cannot be used in IMSM %s: %s is not attached to Intel(R) RAID controller. %s: %s is attached to Intel(R) %s %s (%s), but the container is assigned to Intel(R) %s %s (). Mixing devices attached to different controllers is not allowed. %s: imsm: Free space is %llu but must be equal or larger than %llu. %s: imsm: Not enough devices with space to create array. %s: attempting to create a second volume with size less then remaining space. %s: cannot find imsm_dev with index %u in imsm_super %s: Failed to update subarray %s %s: imsm: imsm_disk_slot_to_ord %d out of range 0..%d %s: data-offset not supported by imsm %s: This imsm-container already has the maximum of %d volumes %s: unable to add 'missing' disk to container %s: imsm does not support more than 2 disksin a raid1 volume %s: imsm does not support consistency policy %s %s: could not allocate superblock %s: could not allocate migr_rec buffer %s: could not allocate new mpb %s: failed for device %d:%d %s %s: Failed to retrieve serial for %s %s: no active Intel(R) RAID controller found. %s: imsm capabilities not found for controller: %s (type %s) %s: no active Intel(R) RAID controller found under %s 3rd party NVMe :%s supported %s: failed to get devices attached to VMD domain. %s: port_count %d out of range %s: failed to determine port number for %s Port%d : - non-disk device (%s) - Port%d : - disk info unavailable - Port%d : - no device attached - %s: failed to enumerate ports on %s controller at %s. %s: error: unsupported process update type:(type: %d) %s: error: imsm_activate_spare passed an unknown disk (index: %d) %s: subarry index %d, out of range %s: shall be used in mdmon context only %s: %s: Cannot add spare devices to IMSM volume %s: %s is not a member of the same container. %s: Member %s is in %d slot for the first volume, but is in %d slot for a new volume. %s: Raid members are in different order than for the first volume, aborting. %s: Combining drives of different sector size in one volume is not allowed %s: %s has been included in this array twice %s: failed to retrieve scsi serial, aborting %s: failed to get dev paths, aborting %s: %s controller supports Multi-Path I/O, Intel (R) VROC does not support multipathing %s: The action you are about to take may put your data at risk. Please note that x8 devices may consist of two separate x4 devices located on a single PCIe port. RAID 0 is the only supported configuration for this type of x8 device. %s: Platform configuration does not support non-Intel NVMe drives. Please refer to Intel(R) RSTe/VROC user guide. %s: deleting subarray-%d would change the UUID of active subarray-%d, aborting %s: imsm: bitmap validation failed %s: imsm: cannot zeroing the space for the bitmap failed for device %d:%d (fd: %d)%s %s: imsm: dev size of subarray %d is incorrect Migration Record Information: Empty Examine one of first two disks in array Status : Current Unit : %llu Family : %u Ascending : %u Blocks Per Unit : %u Dest. Depth Per Unit : %u Checkpoint Area pba : %llu First member lba : %llu Total Number of Units : %llu Size of volume : %llu Record was read from : %u %s: Cannot seek to anchor block: %s %s: Cannot read migr record block: %s %s: Cannot write migr record block: %s %s: %s: device to small for imsm %s: Cannot seek to anchor block on %s: %s %s: Failed to allocate imsm anchor buffer on %s %s: Cannot read anchor block on %s: %s %s: unable to allocate %zu byte mpb buffer %s: IMSM checksum %x != %x on %s %s: Cannot seek to extended mpb on %s: %s %s: Cannot read extended mpb on %s: %s ARRAY /dev/md/%.16s container=%s member=%d UUID=%s Multiple PPLs on journaling drive%s: cannot open device %s: %s %s: Conflict, offlining family %#x on '%s' %s: Chose family %#x on '%s', assemble conflicts to new container with '--update=uuid' %s: Unsupported migration detected%s: cannot allocate memory for imsm supertype %s: RAID geometry validation failed. Cannot proceed with the action(s). %s: imsm: Not enough devices with space for this array (%d < %d) %s: %s is not in the same imsm set %s: %s is a spare and a volume is already defined for this container %s: The option-rom requires all member disks to be a member of all volumes %s: unable to determine free space for: %s %s: %s not enough space (%llu < %llu) %s: no free space left on device. Aborting... %s: not enough space to create volume of given size (%llu < %llu). Aborting... %s: platform does not support more than %d raid volumes. %s: %d exceeds maximum number of platform supported disks: %d %s: %s exceeds maximum platform supported size %s: NVMe namespace %s is not supported by IMSM %s: Given size must be greater than 1M. %s: superblock must be set for autolayout, aborting %s: Cannot create this array on device %s %s: Cannot use %s: It is busy %s: failed container membership check %s: Disk %s is not used in first volume, aborting %s: No OROM/EFI properties for %s %s: Failed to load all information sections on %s %s: Cannot read copy area block: %s %s: Cannot restore data from backup. Too many failed disks %s: Unsupported attributes in IMSM metadata.Arrays activation is blocked. %s: cannot assemble volume '%.16s': unsupported migration in progress %s: IMSM RAID geometry validation failed. Array %s activation is blocked. %s: Error. Requested Layout not supported (left-asymmetric layout is supported only)! %s: Error. Level Migration from %d to %d not supported! %s: Error. Layout Migration from %d to %d not supported! %s: Error. Chunk size change for RAID 10 is not supported. %s: Error. Size change should be the only one at a time. %s: New chunk size (%dK) does not evenly divide device size (%lluk). Aborting... %s: imsm: Cannot retrieve data disks. %s: imsm: Cannot find free space for expand. %s: imsm: Rounded requested size is 0. %s: imsm: Rounded requested size (%llu) is larger than free space available (%llu). %s: imsm: Rounded requested size (%llu) is same as current size (%llu). %s: imsm: Size reduction is not supported, rounded requested size (%llu) is smaller than current (%llu). %s: Error. Cannot perform operation on %s- for this operation it MUST be single array in container %s: imsm: ERROR: Cannot get spare devices for %s. %s: (imsm) Operation is not allowed on this container %s: cannot get spare device for requested migration %s: Cannot find %s (%s) subarray Number of migrating volumes greater than 1 There is no volume during migrationg raid5 raid10 raid1e raid1 raid0 64M 32M 16M 8M 1M 512k 256k 128k 64k 32k 16k MD_FIRMWARE_TYPE=imsmIMSM_VERSION=%d.%d.%d.%d IMSM_2TB_VOLUMES=%s IMSM_2TB_DISKS=%s IMSM_MAX_DISKS=%d Bad-blocks on %s: %20llu for %d sectors missing/sys/dev/block%s: cannot open device: %s enterprise raid5 raid10 raid1e raid1 raid0 64M 32M 16M 8M 4M 2M 1M 512k 256k 128k 64k 32k 16k 8k 4k 2k not Platform : Intel(R) Matrix Storage ManagerVirtual RAID on CPURapid Storage Technology%s Version : %d.%d RAID Levels :%s%s%s%s%s Max Disks : %d Unknown1.2.011.0.001.1.001.2.021.2.061.2.04IMSM_NO_PLATFORM/proc/cmdlineahciiscinvmeWrite PPL header failed journal active spare Disk%02d Serial : %s Disk Serial : %s State :%s%s%s%s Id : %08x Usable Size : %llu%s RAID controllerErr!Read PPL header failedmissing:%dserialIMSM_DEVNAME_AS_SERIAL/sys/block/ NVMe under VMD : %s NVMe Device : %s%s: found Intel(R) SATA SAS NVMe SATA VMD domain at %s I/O Controller : %s (%s) ata%dhost%d%s: failed to get device model%.64s %.64s%s: %s - invalid path name Port%d : %s () MISSING_%d%s: BUG mpb setup error Write migr_rec failed%u+%llubitmap/metadatabitmap/chunksizebitmap/spacebitmap/time_basebitmap/locationNormalContains DataIntel Raid ISM Cfg Sig. %s: no IMSM anchor on %s super-intel.csuper->disks == NULLprev_map/%s/%d UUID=%s UUID : %s MD_METADATA=imsmMD_LEVEL=containerMD_UUID=%s MD_DEVICES=%u MD_CREATION_TIME=%llu ARRAY metadata=imsm UUID=%s incorrect (out-of-sync)dirty Magic : %s Version : %s Orig Family : %08x Family : %08x Generation : %08x Creation Time : %.24s Attributes : All supportednot supported Checksum : %08x %s MPB Sectors : %d Disks : %d RAID Devices : %d Bad Block Management Log: Log Size : %d Signature : %x Entry Count : %d [%.16s]: Subarray : %d RAID Level : %d <-- %d Members : %d Slots : [ <-- [ Failed disk : %i This Slot : %d%s Sector Size : %u Array Size : %llu%s Per Dev Size : %llu%s Sector Offset : %llu Num Stripes : %llu Chunk Size : %u KiB <-- %u KiB Reserved : %d Migrate State : rebuildgeneral migrationstate change Map State : %s <-- %s Checkpoint : %llu (N/A)(%llu) Dirty State : %s RWH Policy : offPPL distributedPPL journaling driveMultiple distributed PPLsWrite-intent bitmap Volume ID : %u This Slot : ? (IMSM). %s: Cannot open %s: %s %s: imsm: Cannot open %s: %s %s: Error restoring stripes %s: Cannot seek to block: %s %s: Cannot restore block: %s sync_maxdelayed%s: %ssuspend_losuspend_hiSASSATANVMeSATA VMDnormaluninitializedp ГH`X@L |tload_imsm_diskgetinfo_super_imsm_volumemdadm.imsm.test=1Intel Raid ISM C%s: mbr metadata cannot be used this way %s: Cannot read partition table on %s %s: No partition table found on %s Partition[%d] : %12lu sectors at %12lu (type %02x) mbr MBR Magic : %04x %s: gpt metadata cannot be used this way Partition[%02d] : %12llu sectors at %12llu gpt GPT Magic : %llx GPT Revision : %ld %s: RAID%d layout %x with %d disks is unsupported for DDF %s: DDF RAID %u qualifier %u with %u disks is unsupported %s: Unsupported secondary RAID level %u/%u %s: device %d/%d of subarray %d not found in meta data %s: new subarray %d contains broken device %d/%d (%02x) %s: subarray %d doesn't exist %s: no space for sec level config %u, count is %u %s: BUG: other_bvds is NULL, nsec=%u %s: Couldn't find disk %d in array %u %s: no match for BVD %d of %s in update %s: could not allocate other bvds %s: could not allocate vcl buf %s: could not allocate spare info buf %s: could not allocate disk info buffer %s: %s: insufficient data (%d) for %u BVDs %s: no DDF anchor found on %s %s: can only support super revision %.8s and earlier, not %.8s on %s %s: Failed to load primary DDF header on %s %s: Failed to load secondary DDF header on %s %s: %s is too small for ddf: size is %llu sectors. %s: %s is an odd size for ddf: size is %llu bytes. %s: DDF cannot create a container within an container %s: ddf: Not enough devices with space for this array (%d < %d) %s: ddf: %s is not in the same DDF set %s: DDF does not support level %d /layout %d arrays with %d disks %s: not enough devices with space to create array. %s: not enough spare devices to create array. %s: ddf: Cannot create this array on device %s - a container is required. %s: No BVDs for secondary RAID found %s: Secondary RAID level only supported for mirrored BVD %s: Secondary RAID level %d is unsupported %s: Inconsistent secondary RAID level across BVDs %s: Different RAID levels for BVDs are unsupported %s: All BVDs must have the same number of primary elements %s: Different strip sizes for BVDs are unsupported %s: Different BVD sizes are unsupported ARRAY%s%s container=%s member=%d UUID=%s Chunk Size[%d] : %d sectors Secondary Position[%d] : %d of %d Number RefNo Size Device Type/State Physical disks not in metadata!:%s: BUG: can't find disk %d (%d/%d) %s: failed to allocate %d bytes %s: file descriptor for invalid device %s: cannot find raid disk %d (%d/%d) %s: unsupported RAID level/layout %d/%d with %d disks %s: could not allocate vd_config %s: Cannot find spare slot for virtual disk %s: This ddf already has an array called %s %s: device size must be at least 32MB %s: %x:%x: workspace size 0x%llx too big, ignoring %s: could allocate buffer for new disk, aborting %s: No free slot in array, cannot add disk Ȣ(H||`0|||||||||||||||||||||||Х̸&&̸̸ U y y What Is My PID?? faulty%c%s: Write to state_fd failed %02X ( %D %T Container GUID : Seq : %08x Virtual Disks : %d %s: could not find VD %s %s: could not find conf %s %s: bad header magic %s: bad CRC %s: header mismatch %s: bad CRC on anchor on %s 01.02.00%s: malloc of %zu failed. %s: ddf: Cannot open %s: %s %s: ddf: Cannot use %s: %s MD_METADATA=ddfARRAY metadata=ddf UUID=%s /dev/md/Not ConsistentMorphing, pass-through, foreignGlobal-Spare, Missing, Unrecovered-Read-Errors, SMART-errors, in-transition, Rebuilding, FailedOnlineOffline Version : %.8s Controller GUID : Redundant hdr : %s state[%d] : %s, %s%s init state[%d] : %s access[%d] : %s Name[%d] : %.16s Raid Devices[%d] : %d (--@%lluK Raid Level[%d] : %s Secondary Level[%d] : %s Device Size[%d] : %llu Array Size[%d] : %llu Physical Disks : %d %3d %08x %8lluK %-15s %s%s%s%s%s/%s%s%s%s%s%s%s %08x %s VD GUID[%d] : unit[%d] : %d %15s%s: BUG: invalid raid disk %s: nothing to kill %s: couldn't find disk %d/%d %s: cannot find raid disk %d %s: could not allocate vd %s: could not allocate pd %8s%04d%02d%02dInformation: nil%17.17sStripedMirroredConcatSpannedRAID0RAID1RAID3RAID4RAID1EJBODCONCATRAID5ERAID5EERAID6Read/WriteReservedRead OnlyBlocked (no access)Not InitialisedQuickInit in ProgressFully Initialised*UNKNOWN*DegradedDeletedPartially Optimal-reserved- 0w,aQ mjp5cd2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqg<GK k 5lBɻ@l2u\E Y=ѫ0&:QQaп!#ijV(_ $ |o/LhXa=-fAvq Ҙ*q俟3Ըx4  j-=mld\cQkkbal0eNbl{WٰeP긾|bI-|ӌeLXaMQ:t0AJו=mѤjiCn4Fgи`s-D3_L | jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&cju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0º0S$6к)WTg#.zfJah]+o*7 Z-%s/external:%s %s: Failed to unfreeze %s %s: mdmon instance for %s cannot be disabled %s: failed to read /proc/mdstat while disabling mdmon %s: failed to read sysfs for subarray%s %s: failed to freeze subarray%s %s: failed to read /proc/mdstat while unblocking container ZZZZ%s: failed to open bitmap file %s: %s %s: No bitmap possible with %s metadata %s: failed to read superblock of bitmap file: %s %s: WARNING: bitmap file is not large enough for array size %llu! %s: failed to allocate 8192 bytes %s: This is an md array. To view a bitmap you need to examine %s: a member device, not the array. %s: Reporting bitmap that would be used if this array were used %s: as a member of some other array %s: invalid bitmap magic 0x%x, the bitmap file appears %s: to be corrupted or missing. %s: unknown bitmap version %d, either the bitmap file %s: is corrupted or you need to upgrade your tools UUID : %08x:%08x:%08x:%08x Daemon : %ds flush period Bitmap : %llu bits (chunks), %llu dirty (%2.1f%%) Unable to open bitmap file on node: %i Unable to read bitmap on node: %i %s: invalid bitmap magic 0x%x, the bitmap file appears to be corrupted %s: bitmap file %s already exists, use --force to overwrite %s: failed to write superblock to bitmap file %s: %s %s: failed to write bitmap file %s: %s %s: %s doesn't have bitmap Filename : %s Magic : %08x Version : %d Events : %llu Events Cleared : %llu State : %s KB%lu %s Chunksize : %s Allow write behind, max %d Write Mode : %s Sync Size : %llu%s Cluster nodes : %d Cluster name : %-64s Node Slot : %d ftrunaceOKOut of dateGHHtHdHTHDHGY@: memory allocation failure - aborting /sys/bus/pci/drivers/vmd/sys/bus/pci/drivers/vmd/%s/sys/firmware/efi/efivars%s/%s-%s/sys/firmware/efi/vars%s/%s-%s/size%s/%s-%s/data%s/vendorpci/sys/bus/%s/drivers/%s/sys/bus/%s/drivers/%s/%sdeviceclass%s: Cannot read %s, aborting IMSM_TEST_OROM_NORAID5IMSM_TEST_AHCI_EFI_NORAID5IMSM_TEST_SCU_EFI_NORAID5RstSataVRstUefiVIMSM_TEST_AHCI_EFIIMSM_TEST_SCU_EFIIMSM_TEST_OROMRstScuV/configIMSM_SAFE_OROM_SCANIMSM_TEST_AHCI_DEVIMSM_TEST_SCU_DEV%s: Cannot get device paths nsidRstVmdVRstsSatVRsttSatV/sys/bus/pci/drivers/vmd/%s/domain/device%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x/sys/bus/%s/drivers/%s/%s/subsystem/sys/bus/%s/drivers/%s/%s/domain/device%s: Unable to get real path for '%s' /sys/devices/virtual/nvme-subsystem/%s: Cannot read nsid value for %s%s: IMSM is supported on the lowest NVMe namespace Adapter ROM/dev/memVideo ROM;z8^_a@c!\eFfXxohrtDhXPhdxx8(x(hlLh8Xxxh ((Lx 8@x 8 h  80x 4(x(HhxTH XT,(XH8( !0 X" " H% (8!)|!)!*!,!,!, "-("-<".x"."0"x1(#2T#2h#2#85#5#7H$8|$:$:$;%X%(?%?%B8&Cd&8Cx&C&C&D&8G@'Gx'hH'H'8I'I'(J(J,(HK`(K(HL(N)xO8)Od)Q)Q)hR *HT@*hTX*T*hU*V*(W*HW+XP+Y+\,]H,^,h_,_,`-Xa@-aX-al-8b-b-Xk.k0.Hl\.m.m.n/oh/p/p/8r 0xr<0hsp00x0Ȁ0ȁ$1h1(11h2H2|2x223HD3p333h4x44($5(P5Ȗ55$6p6h666x@7X7Xp787H7x$8Ȧp88X9(H99X99x$:(T:::(:8: ;l;;;;;H;x<(<@<X<8<<@===X=8>\>>>(?@???8?h<@@@$Ax\AxA8AAh(BBBC CXCHC(DHDDhDEx`EEE(EhE4FHFFFFhGDGGGGGh(HlH8HIhDIxXItI I( Jh 0JH pJ(JxJ4KPKHhK8KhKK(LXtLLLxM,M(@M`MMMN( NX 4N NH!N!N8"Oh" O"DO%Oh&O&O)4P(+P,P,P,P-P(- QH- Qx-4Q-pQ-QX/Qx/Q/R/R00Rh0DR1XR(1lR1R2R2 S5pS(6S8T89XTx9xT9Th:T;T(< U(=XUx=tU>U?UH@@VhBVEWGHWHtWIWKWKWKXLXHMHXxMdXMXNXNXOX8Q8YQXYQ|Y8RY8SZTLZTpZVZhVZYP[XZ[x[[\\_x\c\c ]el]xf]Hg]g]iD^i`^8p_p(_qX_(rl_xw_xz(`z<`8|x`h}`$axaaȅabXhbbbTcxc(c8 d8hdd8dxpeee8eff glgxg(h8hH0hhDhXhHlhhhxi(ixiih j4jxjXjjx`kk(lh$lX pl(lhmlmmnXDn8nhno+o+o8o88ph>8h@|(EȍL(Nt8QĎ8RRR8XSTSpTTԏXU hV8HWdxX(]h]]D^ldeHftfghȓi j0k`hllXno$qhrrsXs<xsPuxvvwxw4hxXx{| H| |8}}zRx h/D$4 FJ w?:*3$"\ t&E` 2Dm(4EPSd AAA L BBB B(A0D8I3 8A0A(B BBBA L1EAUdh\FHE E(D0H8GP 8C0A(B BBBA  8J0A(B BBBE   &D[$$$ACG VAA@L[BFG q ABE D ABA AGB(AADPc AAE 0XBAA Gv  AABA 0FAA F  AABA H$FED D(G0J (F ABBA D(F ABBHpFBB E(D0D8G@ 8C0A(B BBBG LxIBBB B(A0A8I 8A0A(B BBBA L xqBJE F(A0A8G 8A0A(B BBBF \ EZ4|oBBA A(D0^(A ABB&D[4BJA A(D0(D ABB(ADD } DAE 0T]PoQ LXAGI AA @pDTGH K(N0 (A ABBA W(pBDD ^AB$)L@BBB B(A0A8G? 8A0A(B BBBF D1HZ F DLd3 FBB B(A0A8G 8A0A(B BBBH HFFE B(A0A8D 8A0A(B BBBJ (T/FDI H(G,Xs@HLTFED H(G0 (A ABBI M(A ABB0|BAD D0  AABA (AAD0} AAK (|=BGD jCBDLXNEAD  CAG e CAG h CAD i CAC IEj A X EM`N AG 8 D P( \8< hFBA A(G} (A ABBD 0x FFA D0  AABG  H s E  EG r AA @ dKIA A(G0W (A ABBF G0D |FDI G0G  AABK (x EHGw AAA  pK A , <DXABgH FBE B(H0A8Hp 8A0A(B BBBA < -(P <EKI@ AAE 0| FKA I@  AABA 0 FKD G`  AABH 0 pFGI G`  AABG 8 ,FPD A(I (A ABBC LT OFBA I(G0 (D ABBG O (D ABBH  AD hpv L(a0aK I H z L(a0I Hv L(a0X d9dxi ^AK A R F p M K H M K H M K K a L Ka @\ HHDC K ABC A HIN QDW [ P-< lqFBA A(G I  (A ABBD   0 N F L 08` FGD A(G@C (A ABBF  l FBB B(A0A8DZ 8A0A(B BBBJ dOgAEObA(  ELb@g AAD (LHEAF@{ AAA x ER{ AE L4lFFE B(A0A8I 8A0A(B BBBA TSJCCLFBB B(A0A8N 8A0A(B BBBA 0l8XFFC G  AABG 0dFFD Nt  AABJ 0PFNN V@t  AABH (EIG0 AAJ 04pFNN V@t  AABH Hh KFDB E(D0C8G  8A0A(B BBBB rEM Y AA 0lFDD G0m  AABJ L FIB B(A0A8G 8A0A(B BBBA (\HFAA |AB$IECD xCAk}U88FBF F(D0Y (C ABBG HFDJ E(D0D8DPx 8C0A(B BBBG 4dSDF HABHP h  H`_ I H!;0t!FNO Dz  AABK "*Ha ,"|EM Z AC 0Pt"FMA D@o  AABA 4"QAH vABAN (X#LFDC {ABL|#}FBB B(A0A8D 8A0A(B BBBK 8%EG AA (\8&rEHD@Y AAA 4&FAA y ABD HP0d'BJD A(J`j8'FED K(D@q (A ABBK 00T(FMA N  AABH d* HR0|*GEAF e AAE DEA$*E H D(*EAD0G AAE 8+ E D D(,HI<40,yFDL A(D0 (A BBBB Ltp-FBB A(A0DPxXG`bXAPT 0A(A BBBA ` .FBB A(A0DCBEABEJu 0A(A BBBG @(0 FBB G(F0IP 0A(A BBBA 8lx1FBI A(G (A ABBH 4\2yFED A(D0\(C ABB42FEH A(D0c(C ABB 2ERJ AF $<3ERJ AF d4Rjf|X4+(t4BEDG oAA,4yKAD aABDL4FBB B(A0A8G 8A0A(B BBBE <8=8dS(T`=EFJ AAA @=3FGH A(A0I 0A(A BBBC ,>XFCF A ABA H?FDF A(D0 (A ABBJ D(C DBBH@?FGG H(A0o (A BBBE ^(A BBBL@FDE F(A0H (D BBBH G (A BBBB ,X@xKAD cABA4 @FLP II  AABH DB8El0`4BFAD J  AABG TB FBB B(A0A8G L@IAg 8A0A(B BBBE HO\OI0OFHA GB  AABD @HPFOK DbSHHW  AABD 88QwFON D(Dp@ (A ABBA 8|QwFON D(Dp@ (A ABBA 0QFRP Dv  AABJ 08LRE\oNZA_ DA 0lREYbSHH` AD 04SFHC Dp  AABH (S?EDD b CAE 8S:FEA F(I (A ABBK (<TGFDD d ABK (hTGFFE e ABG ( UGFDD d ABK (DUEQOPi AAA DUFBB A(A0J 2 0A(A BBBH d4 PYFBB B(A0A8G L@I@| 8A0A(B BBBH @hAK@D@X x\FBB B(A0A8GR 8A0A(B BBBG XvPDL ]FOO L(A0A8G= 8A0A(B BBBA (H!^EJG@x AAH 8t!_FGD A(Iy (A ABBF T!4aLFBA A(G L@LB^BCBdBAB (A ABBI <",bFBB H(A0 (A BBBE HH"bFGB B(I0A8D@ 8A0A(B BBBE "e[HM _H"eBBB B(A0A8D` 8A0A(B BBBE "(iG A H#iFBE A(A0Q (D BBBF G(A EBBd#0jHU|#8jL#jFBA A(D0 (A ABBH B (F ABBK #plL#ll-EAD ] CAE _ FAJ \ FAE _ FAA HH$LmHFPB E(A0A8G 8A0A(B BBBA H$Pn?FFB B(A0A8DP 8A0A(B BBBG P$DoCPBE K(C0O (A BBBE xH044%@qFBA A(D0(A ABBLl%qFBB B(A0A8G 8A0A(B BBBK $%XyREAD EAA8%yFBA A(D@ (A ABBA $ &zREAD EAA,H&LzFAA N ABG ,x&zyFAA W ABF $&{XEAD KAA&T{&`{ H&\{FIB E(K0A8D` 8A0A(B BBBF HD'FBB B(A0A8Jg 8A0A(B BBBG ('tACD  AAJ ''0RP'0RP(40RP(L-Ka4(`0RPL(x/ROd(0RPL|(&FBB B(A0A8Dx 8A0A(B BBBD H(xFBA A(D0M (C ABBE D(F ABBH)LEB A(D0 (A EBHN A(F BBB@d)FBB A(A0G 0A(A BBBD ,)<&FMG  ADN $)FBB B(A0A8G L@LC`CECKCOCKC| 8A0A(B BBBC 0, FDA G  AABA H,ؖ<FEE E(D0D8D` 8A0A(B BBBC 4H-̗{FDD O ABH OAB-2Q`4-8uFAD n ABD U ABH 4-zFAA v ABG U ABH < .ȘFDA P ABB ^ ABG lL.8FBB B(D0D8G 8A0A(B BBBG bPiAkOiA8.xFHA m CBG A FBG (. FHD Y ABB $/3HV B P4D/FDH  HBH `CB\|/V FEE B(D0D8J 8A0A(B BBBE !eIA`/BBB B(A0A8D`} 8A0C(B DBED a8F0A(B BBB(@0VBDD HAB<l08KBJB D(D0a (D BBBG \0HBBE G(D0b (A BBBC t (A BFBA A(C BBB$ 1x?ADG nCAL41BBB B(A0A8Gi 8A0A(B BBBD ,1bFDD v AAJ Q1P1$1h8ADD eDAP2%BBB B(A0A8G L" 8A0A(B BBBA X2\=Ll2FBE B(A0A8D 8A0A(B BBBG 28ET02<FRA J  AABF  3{Kj A <(3\SNBB D(A0 (H BBBG Dh3|EFBB A(F0L 0A(A BBBA (3FHA kKB3)JWG3EX44aFED D(D0@(D ABB@L48OEK D(D0g (A ABBD Cd4"TEE B(H0D8D@e 8F0A(B BBBD 8A0A(B BBBA(4\HFDF tAB@$5FBB A(A0D@ 0A(A BBBA h5 |5)JWGD5,SFAA G I  D H A f  AABG \5DFBB B(A0A8G I w L ` A r 8A0A(B BBBB @65<T60EAGd AAE NI]AH6FBB B(A0A8D` 8A0A(B BBBA 86dGFAA G I   AABE 87xDFBA D(JI (A ABBJ X7AEW F t7+MS,7EAG I  AAA 7#7sKb A \7FBB B(A0A8Gg 8A0A(B BBBJ McAHL8xFBB E(A0C8LP 8D0A(B BBBJ H8WBPB B(A0A8DP 8A0A(B BBBD 888FSA D(U (A ABBG 49`sKb A P9#d9o\yKHL90AFBA A(G0 (M FBBI K (D ABBL 90ES894FBA A(D@ (A ABBH ,:2HiD:0HX:FJA A(D0^ (D ABBC D(D DBB$:pGEDD pDA0:FAA D0  AABA (;HEAD \ AAA ,;($HW D;@ESf AA @h;FBB D(A0G 0A(A BBBD (;END Y AAA ;.E]`;fFEE E(D0A8GPpXD`\XDPE 8D0A(B BBBI ]XE`XXFPHX<FGE E(A0D8G 8A0A(B BBBB 4<FII O  AABF <*Ha< = =0=D= /8X=<^KBD N(D0i(A ABBF=`ELL=`YOEB A(D0 (I BBBK @>p>|7,>;@> T>Uh>|>,>kQDD FABF4>eBBA A(D0T(A ABB4>,FAA  ABH DAE`0?BBB E(D0A8FPW 8A0A(B BBBA h 8A0A(B BBBA ?p?Tj?BBB B(A0K8D`hCpQhV`hFpFxITBAFKDDAK`r8C0H(G BBBD4@BBB B(A0A8DPp8D0A(B BBB|@:An I A@a@T{sH@kFBB E(A0A8DP 8C0A(B BBBD ALA{ D H0ABBB B(A0A8DP 8A0A(B BBBG |AJAn I 0A BAD F@A  AABF HABED A(D0Z (D ABBE D(F ABBHB$BBB B(A0A8DPr 8C0A(B BBBD LdBBBB B(A0A8G  8A0A(B BBBH B@BKB B(A0I8D`hCpQhV`hFpFxIMBAFKDDAK`x 8A0H(G DBBH (@CE E h H Q G (lC8ANN@h AAA PCFBB B(A0A8G I  8A0A(B BBBI CAD$D(DG,HHX<BBE B(A0D8Dp 8A0A(B BBBA HXFBE B(A0A8Dp 8D0A(B BBBA HXd8FBB E(D0A8D` 8D0A(B BBBF `,YXHFBB B(A0A8D` 8A0A(B BBBF K 8A0A(B BBBE LYDFDB B(A0A8J 8A0A(B BBBC @YFBB A(D0G 0A(A BBBA @$ZFBB A(D0G 0A(A BBBA 8hZ FDA D(G (A ABBA HZ$FBB B(A0A8G~ 8A0A(B BBBC 0ZFCD Gj  AABA L$[ FBB B(A0A8G ! 8A0A(B BBBH $zRx  ,]4[tFAD  FBD ACB,[[ AE HK F \L,\(BBBB B(A0A8Qk 8A0A(B BBBH \|\(BEE B(A0A8D} 8A0A(B BBBE DmAH\BBA A(D0R (C ABBL G (D ABBH d(](BBB B(A0A8D`ghWpIhA`@ 8A0A(B BBBH hNpYhD`|]#FBE B(A0A8Dp^xKBARp\ 8A0A(B BBBG xOPxBpxIBARpH^tFBB E(F0A8FP 8D0A(B BBBA \^@p^FBB A(A0D@^ 0A(A BBBA zRx @(Z*(^cEC FH A 4_LFED A(F0k(C ABBLP_MFBB B(A0A8D  8A0A(B BBBK \_jFEB B(A0A8GKOA 8A0A(B BBBF h`FBG E(A0A8JHPBBBI 8A0A(B BBBJ Hl`XFBD D(D0Y (C ABBK \(C ABBL`xFMB E(G0D8G 8A0A(B BBBC 0X LaGFIG B(G0D8Gg 8A0A(B BBBE @laYFGB D(A0M 0A(A BBBH haFBB B(A0A8G 8A0A(B BBBJ MAABBbb0Hg4bEUPbccv@hbzFEB D(D0D@w 0A(A BBBH 8b8QFJA H(D@\ (A ABBA b\~,bkFQC p ABC ,c0HgDc EU`c$lEV E KHctIFBB E(D0D8D`y 8A0A(B BBBB cx (c FJA AB, dh uFDC bCB##dyqr0-1=1@1KCO1`1c1s1v1111#1>#11ux1111111 X$vp<1opTC11'Xp%1C22_p cp HK#u00TCXC22 212@21P2S2V2lY2f2r22 2 222222 212@21P2S2V2lY2f2r222homehostnoyes/etc/mdadm/mdadm.conf.d/etc/mdadm/mdadm.conf/etc/mdadm.conf.d/etc/mdadm.conf%mJJ>>>10>#?>??BB#<@<@@+@>@! # do not edit this file, it is automatically generated by mdadm autodomainactionmetadatapart-policypolicytypepathdiskpart The config file contains, apart from blank lines and comment lines that start with a hash(#), array lines, device lines, and various configuration lines. Each line is constructed of a number of space separated words, and can be continued on subsequent physical lines by indenting those lines. A device line starts with the word 'device' and then has a number of words which identify devices. These words should be names of devices in the filesystem, and can contain wildcards. There can be multiple words or each device line, and multiple device lines. All devices so listed are checked for relevant super blocks when assembling arrays. An array line start with the word 'array'. This is followed by the name of the array device in the filesystem, e.g. '/dev/md2'. Subsequent words describe the identity of the array, used to recognise devices to include in the array. The identity can be given as a UUID with a word starting 'uuid=', or as a minor-number stored in the superblock using 'super-minor=', or as a list of devices. This is given as a comma separated list of names, possibly containing wildcards, preceded by 'devices='. If multiple critea are given, than a device must match all of them to be considered. Other configuration lines include: mailaddr, mailfrom, program, monitordelay used for --monitor mode create, auto used when creating device names in /dev homehost, homecluster, policy, part-policy used to guide policy in various situations For more details see mdadm.conf(5). Usage: mdadm --incremental [-Rqrsf] device This usage allows for incremental assembly of md arrays. Devices can be added one at a time as they are discovered. Once an array has all expected devices, it will be started. Optionally, the process can be reversed by using the fail option. When fail mode is invoked, mdadm will see if the device belongs to an array and then both fail (if needed) and remove the device from that array. Options that are valid with incremental assembly (-I --incremental) are: --run -R : Run arrays as soon as a minimal number of devices are : present rather than waiting for all expected. --quiet -q : Don't print any information messages, just errors. --rebuild-map -r : Rebuild the 'map' file that mdadm uses for tracking : partial arrays. --scan -s : Use with -R to start any arrays that have the minimal : required number of devices, but are not yet started. --fail -f : First fail (if needed) and then remove device from : any array that it is a member of. Usage: mdadm --grow device options This usage causes mdadm to attempt to reconfigure a running array. This is only possibly if the kernel being used supports a particular reconfiguration. Options that are valid with the grow (-G --grow) mode are: --level= -l : Tell mdadm what level to convert the array to. --layout= -p : For a FAULTY array, set/change the error mode. : for other arrays, update the layout --size= -z : Change the active size of devices in an array. : This is useful if all devices have been replaced : with larger devices. Value is in Kilobytes, or : the special word 'max' meaning 'as large as possible'. --assume-clean : When increasing the --size, this flag will avoid : a resync of the new space --chunk= -c : Change the chunksize of the array --raid-devices= -n : Change the number of active devices in an array. --add= -a : Add listed devices as part of reshape. This is : needed for resizing a RAID0 which cannot have : spares already present. --bitmap= -b : Add or remove a write-intent bitmap. --backup-file= file : A file on a different device to store data for a : short time while increasing raid-devices on a : RAID4/5/6 array. Also needed throughout a reshape : when changing parameters other than raid-devices --array-size= -Z : Change visible size of array. This does not change any : data on the device, and is not stable across restarts. --data-offset= : Location on device to move start of data to. --consistency-policy= : Change the consistency policy of an active array. -k : Currently works only for PPL with RAID5. Usage: mdadm --monitor options devices This usage causes mdadm to monitor a number of md arrays by periodically polling their status and acting on any changes. If any devices are listed then those devices are monitored, otherwise all devices listed in the config file are monitored. The address for mailing advisories to, and the program to handle each change can be specified in the config file or on the command line. There must be at least one destination for advisories, whether an email address, a program, or --syslog Options that are valid with the monitor (-F --follow) mode are: --mail= -m : Address to mail alerts of failure to --program= -p : Program to run when an event is detected --alert= : same as --program --syslog -y : Report alerts via syslog --increment= -r : Report RebuildNN events in the given increment. default=20 --delay= -d : seconds of delay between polling state. default=60 --config= -c : specify a different config file --scan -s : find mail-address/program in config file --daemonise -f : Fork and continue in child, parent exits --pid-file= -i : In daemon mode write pid to specified file instead of stdout --oneshot -1 : Check for degraded arrays, then exit --test -t : Generate a TestMessage event against each array at startup Usage: mdadm misc_option devices... This usage is for performing some task on one or more devices, which may be arrays or components, depending on the task. The --misc option is not needed (though it is allowed) and is assumed if the first argument in a misc option. Options that are valid with the miscellaneous mode are: --query -Q : Display general information about how a device relates to the md driver --detail -D : Display details of an array --detail-platform : Display hardware/firmware details --examine -E : Examine superblock on an array component --examine-bitmap -X: Display contents of a bitmap file --examine-badblocks: Display list of known bad blocks on device --zero-superblock : erase the MD superblock from a device. --run -R : start a partially built array --stop -S : deactivate array, releasing all resources --readonly -o : mark array as readonly --readwrite -w : mark array as readwrite --test -t : exit status 0 if ok, 1 if degrade, 2 if dead, 4 if missing --wait -W : wait for resync/rebuild/recovery to finish --action= : initiate or abort ('idle' or 'frozen') a 'check' or 'repair'. Usage: mdadm [mode] arraydevice [options] This usage is for managing the component devices within an array. The --manage option is not needed and is assumed if the first argument is a device name or a management option. The first device listed will be taken to be an md array device, any subsequent devices are (potential) components of that array. Options that are valid with management mode are: --add -a : hotadd subsequent devices to the array --re-add : subsequent devices are re-added if there were : recent members of the array --remove -r : remove subsequent devices, which must not be active --fail -f : mark subsequent devices a faulty --set-faulty : same as --fail --replace : mark device(s) to be replaced by spares. Once : replacement completes, device will be marked faulty --with : Indicate which spare a previous '--replace' should : prefer to use --run -R : start a partially built array --stop -S : deactivate array, releasing all resources --readonly -o : mark array as readonly --readwrite -w : mark array as readwrite Usage: mdadm --assemble device options... mdadm --assemble --scan options... This usage assembles one or more raid arrays from pre-existing components. For each array, mdadm needs to know the md device, the identity of the array, and a number of sub devices. These can be found in a number of ways. The md device is given on the command line, is found listed in the config file, or can be deduced from the array identity. The array identity is determined either from the --uuid, --name, or --super-minor commandline arguments, from the config file, or from the first component device on the command line. The different combinations of these are as follows: If the --scan option is not given, then only devices and identities listed on the command line are considered. The first device will be the array device, and the remainder will be examined when looking for components. If an explicit identity is given with --uuid or --super-minor, then only devices with a superblock which matches that identity is considered, otherwise every device listed is considered. If the --scan option is given, and no devices are listed, then every array listed in the config file is considered for assembly. The identity of candidate devices are determined from the config file. After these arrays are assembled, mdadm will look for other devices that could form further arrays and tries to assemble them. This can be disabled using the 'AUTO' option in the config file. If the --scan option is given as well as one or more devices, then Those devices are md devices that are to be assembled. Their identity and components are determined from the config file. If mdadm can not find all of the components for an array, it will assemble it but not activate it unless --run or --scan is given. To preserve this behaviour even with --scan, add --no-degraded. Note that "all of the components" means as many as were present the last time the array was running as recorded in the superblock. If the array was already degraded, and the missing device is not a new problem, it will still be assembled. It is only newly missing devices that cause the array not to be started. Options that are valid with --assemble (-A) are: --bitmap= : bitmap file to use with the array --uuid= -u : uuid of array to assemble. Devices which don't have this uuid are excluded --super-minor= -m : minor number to look for in super-block when choosing devices to use. --name= -N : Array name to look for in super-block. --config= -c : config file --scan -s : scan config file for missing information --run -R : Try to start the array even if not enough devices for a full array are present --force -f : Assemble the array even if some superblocks appear : out-of-date. This involves modifying the superblocks. --update= -U : Update superblock: try '-A --update=?' for option list. --no-degraded : Assemble but do not start degraded arrays. --readonly -o : Mark the array as read-only. No resync will start. Usage: mdadm --build device -chunk=X --level=Y --raid-devices=Z devices This usage is similar to --create. The difference is that it creates a legacy array without a superblock. With these arrays there is no different between initially creating the array and subsequently assembling the array, except that hopefully there is useful data there in the second case. The level may only be 0, 1, 10, linear, multipath, or faulty. All devices must be listed and the array will be started once complete. Options that are valid with --build (-B) are: --bitmap= : file to store/find bitmap information in. --chunk= -c : chunk size of kibibytes --rounding= : rounding factor for linear array (==chunk size) --level= -l : 0, 1, 10, linear, multipath, faulty --raid-devices= -n : number of active devices in array --bitmap-chunk= : bitmap chunksize in Kilobytes. --delay= -d : bitmap update delay in seconds. Usage: mdadm --create device --chunk=X --level=Y --raid-devices=Z devices This usage will initialise a new md array, associate some devices with it, and activate the array. In order to create an array with some devices missing, use the special word 'missing' in place of the relevant device name. Before devices are added, they are checked to see if they already contain raid superblocks or filesystems. They are also checked to see if the variance in device size exceeds 1%. If any discrepancy is found, the user will be prompted for confirmation before the array is created. The presence of a '--run' can override this caution. If the --size option is given then only that many kilobytes of each device is used, no matter how big each device is. If no --size is given, the apparent size of the smallest drive given is used for raid level 1 and greater, and the full device is used for other levels. Options that are valid with --create (-C) are: --bitmap= -b : Create a bitmap for the array with the given filename : or an internal bitmap if 'internal' is given --chunk= -c : chunk size in kibibytes --rounding= : rounding factor for linear array (==chunk size) --level= -l : raid level: 0,1,4,5,6,10,linear,multipath and synonyms --parity= -p : raid5/6 parity algorithm: {left,right}-{,a}symmetric --layout= : same as --parity, for RAID10: [fno]NN --raid-devices= -n : number of active devices in array --spare-devices= -x : number of spare (eXtra) devices in initial array --size= -z : Size (in K) of each drive in RAID1/4/5/6/10 - optional --data-offset= : Space to leave between start of device and start : of array data. --force -f : Honour devices as listed on command line. Don't : insert a missing drive for RAID5. --run -R : insist of running the array even if not all : devices are present or some look odd. --readonly -o : start the array readonly - not supported yet. --name= -N : Textual name for array - max 32 characters --bitmap-chunk= : bitmap chunksize in Kilobytes. --delay= -d : bitmap update delay in seconds. --write-journal= : Specify journal device for RAID-4/5/6 array --consistency-policy= : Specify the policy that determines how the array -k : maintains consistency in case of unexpected shutdown. --write-zeroes : Write zeroes to the disks before creating. This will bypass initial sync. Any parameter that does not start with '-' is treated as a device name or, for --examine-bitmap, a file name. The first such name is often the name of an md device. Subsequent names are often names of component devices. Some common options are: --help -h : General help message or, after above option, mode specific help message --help-options : This help message --version -V : Print version information for mdadm --verbose -v : Be more verbose about what is happening --quiet -q : Don't print un-necessary messages --brief -b : Be less verbose, more brief --export -Y : With --detail, --detail-platform or --examine use key=value format for easy import into environment --force -f : Override normal checks and be more forceful --assemble -A : Assemble an array --build -B : Build an array without metadata --create -C : Create a new array --detail -D : Display details of an array --examine -E : Examine superblock on an array component --examine-bitmap -X: Display the detail of a bitmap file --examine-badblocks: Display list of known bad blocks on device --monitor -F : monitor (follow) some arrays --grow -G : resize/ reshape and array --incremental -I : add/remove a single device to/from an array as appropriate --query -Q : Display general information about how a device relates to the md driver --auto-detect : Start arrays auto-detected by the kernel mdadm is used for building, managing, and monitoring Linux md devices (aka RAID arrays) Usage: mdadm --create device options... Create a new array from unused devices. mdadm --assemble device options... Assemble a previously created array. mdadm --build device options... Create or assemble an array without metadata. mdadm --manage device options... make changes to an existing array. mdadm --misc options... devices report on or modify various md related devices. mdadm --grow options device resize/reshape an active array mdadm --incremental device add/remove a device to/from an array as appropriate mdadm --monitor options... Monitor one or more array for significant changes. mdadm device options... Shorthand for --manage. Any parameter that does not start with '-' is treated as a device name or, for --examine-bitmap, a file name. The first such name is often the name of an md device. Subsequent names are often names of component devices. For detailed help on the above major modes use --help after the mode e.g. mdadm --assemble --help For general help on options use mdadm --help-options Usage: mdadm --help for help -ABCDEFGIQhVXYWZ:vqb:c:i:l:p:m:n:x:u:c:d:z:U:N:sa:rfRSow1tye:k:-ABCDEFGIQhVXYWZ:vqb:c:i:l:p:m:n:x:u:c:d:z:U:N:sarfRSow1tye:k:-ABCDEFGIQhVXYWZ:vqbc:i:l:p:m:r:n:x:u:c:d:z:U:N:safRSow1tye:k:-ABCDEFGIQhVXYWZ:vqbc:i:l:p:m:n:x:u:c:d:z:U:N:sarfRSow1tye:k:mdadm - v4.2 - 2021-12-30 - 19 %%@% %|%x%r%j%f%1@1H1AuxB1CIDIEIF1G1II_IQIX16I8I9I:JZ ]Ja%Jb*Jc1F h2J='V?JvGJqJKMJK3lVJO3O]JnhJnuJxJx'Lz#PJ,J-#tedyWJ.J/JLJMJNbC004J`0e0fJhJk0u0R5(NJKs KQKUK[eCA)KB3KC#D?KEDKEOKFWKG\KR`KS#oeKwoK1(I{K76$dKgK>K?KY02KtK^KS>TKTKU$dKVKVK1KiKyK<L3LY!LZ2\,LX1;/dev/disk/by-path/@<P-hPh@`P Py ~ Ёpwt 0gа  K @p('@*uP p`0T|`$#%!!  |Linux-MD@`7`<@r y: 6FPcph`7%@/opr C 1LK(/7=CI!OV[bi%qwώm  GA$3a1Y?t GA$3p1113oGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*o5 GA*GOW*GA$3a1@t GA$3p1113PGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*Pk GA*GOW*GA*@ GA*GOW*GA* GA*GOW* GA*FORTIFYuGA+GLIBCXX_ASSERTIONS GA*FORTIFYPGA+GLIBCXX_ASSERTIONSmdmon-4.2-19.el8_10.x86_64.debugq7zXZִF!t/q]?Eh=ڊ2N΁%EoǓi- ?*dƀD7j^[!f=~:6ӸMnKyUlBDqgo6g6N}ٖF&!RO2Hk0b[_neSXJ0^'yȭif@k+X2В6Ѹ=:E}tk%:0$?#YXyP\#~?)[p8 &H|_ÊhIz\uf5Rhd`0Y,|5s$l4"pT> M,fg&XpMf'&`& aFkd_z߷܉-{F uZkPxI8\MKڋQNH½)F2:TqwVIOC}700?31՜h)ugbZFCh5Kta3v0 v _H+V5:!)7G/YQulB,gY4D=v0V@0]K3hq|Ĺc߱tz3uuP0FI`ѯ&mAc9"Chj٨K /$`ZGrQR_yW}Z çEen^y-R %Xݥd&kr6Z_Z'ssOU;O\mpj@/7K ktcO[Q|P Zs jsj[ڙGRTA_` ~2z[G(G"#̙"82 v{y3DƵB3xbzm.elc?]ӃIt@G#τüQ۵q~'֐XGjl0Ia!Q ˄uc*$۸_1_u! R_[:R|⫟n#R1MYf i*gMQy( EK+:,/1Vnu+}8!vb/BvuV7g"}X*;_ɚ)l] B"oU)mRFŹJj `SxJ)3?-+YϹB/)ɡHASܕg nT|RkǧND7 ٙcAy\inx?p=TL35X ̀5`D KTn{(tH i@XCu uwoL᯿!=3)ϥy5/hr݀6FQݡ8/"`jc0Arf\| 捖Y _6וIK$T;Z%rD #,gxDؿ vثM$n_OT[y]Qj#4\%'"0~:Bų}00((nٱ&2-Z)zJ;-,M4-xy*(Z/S!*m w@&M% '5u3/I*y2";m鸢W!*:'"!1L>"4ƄqiZ wؤiI-؍Jf"AUwm^V;Ȱ%Nmz4l%E1HazI![UG#GI51Zj-XNO$<*IF]%D7Av,,)FQ7&Q0m sjxjd 9 YWvG$=xOl*0`<08^4U,0s3lIC>[ 6PLi!QZ bG#<0N`˅:qaEn,㎈2Uv00q;L`V W*M@xD0LYz>~B󳴛٦CODu{c /(X#@NXlT"KYxԯ?-)`sdz 0ɂNPg@vsT_sLF7g6mO,|>o 0qzq9SCȦf?6> ^A6u\8o7 Efg|&lNu@NOaH>F#pW-"FԔ`{ײafE65,W23$#AcIeNBUn"ӿ4_,ceGAJ T F:̗P,ꟁ3^h /whxlٯ/޷^)243i|A+|{{o\*]f#kђiPxJHC`jV >ۉN>ɴkzj&gy9m6qCu}6WƜpxhU7aLJ3J.'ʍ)n&KltXޖH,yhOکpv;`Yi'_UjB~->Ļ7 ^L *UwqDLrYd!<ڂ.(M@#a]̽߫P@$-Y0q0Clƾp2`u*.?0D*盃}H>¤`c;:0_,ٍ9 doML++{y[a^ s>.FAg Mo1Eϵ^CI o`:4A1R4-GZ&*PDqqJS‡~~r/ s|U(,k&.=L#uD1.d|ͧP1͈rQtFәv{1C,pWwʆ/D;D9O笝Ka57 %d-15l,)0_Q:l{:/fM? 8(X&dZhЍ۬Kzw̔(дkC=8ZMy-apd~ FZOI씺'l/MRbk"x>•OTy>P~B>?sο=֜%7?0kkfx9_\1V EtS',6jqUMߜl od=C61~ g9͎Dښ?nVZ.pm(ec RڇHjj5[ISM}\]MؑUz8Jn:,Ě=L_RElH"۰+Nym Haz'G(ΌmI);$G_ y뮍U܇ nT)CKXTKT^&Sz tAlxM} FA7uWY9 K3^ttR[;6q#mLcaOD}x>? Udx\K5{;-rC9S @D&H&cpf-^qAzR6v x, g\G{o%?bXz8R)R|縯¸*XoNۨ=7.X{.ݟ2ޣVbwQ٘e͡ 2?d" aեwF=bCF_WD0[Dƒ5A[ e3 }3=yzuHr}B~1Y_;^TLv;wI dxr~Zt3H6dtMNA:Ar7% b t42?|OgէϽfhXf&6.Cv~Cv\}Τg:;}?,V2LP%*::Ifn_Q }2Q"(u1tB{OW&1|&] 6+| kղTu$VӞsŖʲATfIJ#QSMG;0AI$<:aBՐ0+'/"~ȴ@e=?M`.Y(hC۪nm?ސL p/+̽ް+z?QLn#8%-ꖨhyTK\eiud vga+qK$̎3&ߞ@zi>&DŽP IqP+#Ȍ'Y#?UK2䐶xDZܿt\?`*£:Ҵʷu1i5ӎ!UՎQVyoQ?`v")|eWwlVhW/Za7sײ;!o&! ps ;zuv/Op◚h+w0n;睢R-a^Y@29U%9vWif π:*KrWF^R}uc7 <{}wqx(\5RfҒ6! fñ,^LJ1-|1L~t|.fphUIZɨoN{ی@#O_hwgoޜ݈6H eZ^0sw"DUm^R;*V8u*'"|uT[候J/_Vi(ΩW!2-lW [:8ʉm%-h(5-DfPt#RJ~ r]7Gu zz]5)/y4yVXE,p OsOln{!HN`{a%LEsٌ8PsУQnwޅA&`6izWup $0cQo%2]'L^Gʡ >B1 qOmu6^n^ᎻݯB}/Qd5;  !*@c`FB{uxM>F&k}՞V0sDZw23 UY &pp7ƏBAbxBLH`mҜnڛӨo &0=k-"ufRgMQg۝餎:@ `7n}%J2_XH08IXw^J6dD)ƺaD6""\zQ9H_njL-h[D뉩 c$2W2IUCTZl,jr14!F[H/R}-01;Zֺ ʬuݱ-kހu*NBK>! 5v&61k9 %lNyb#/qޅ }4Wtlܗ Zi(?a61E-,m.(SaX·߮-Ϲ:qm E_KZ}.)gRUًGMf4W5t޺D6w!NI1ȪI32CX&`?񁖴 i-Eqm@MAgdh~]k: m5JߒK+?JTj::>zkW cE)ɜJ z$c '|ⵉ/YvE2(¡#ר(b*R't*UI0^vir$A|?t@RDKK"5͚"2Qa#@xpj(]Pl4Hjd{IwsznBd. ?cHsNGowXR4P ,(O~i+1!r 9&AZ ylBTZ 8U95r_ -\P9JG^9޽hl`Yyg# =u{X~@Эp jGVۖFTSMl\_g *L5`EK|D^tl<?>Z VՄF+kP Mc(qHrNmXo.]ADg|M DBbÊL[Q=EVdN3+WRsժ{iE p`a ~|jl# A[fʩMU:b5"d,e:Ncvwl\BuUQ0v2 Ҥ㮻#DZƷ҅4@ Bi"IC,gNG@rvM e-9|{qty|ub#qnO߬paYĆ.ߤ)ap[X[i44XOERs)>`+C@uOwٙ|ޢ_si_%/- *R%<ߠ"YM/qed$CsگMw1&} dGXÁzҤ6cW:pw-y[G+&ᬻם!l|(I#'ҳOw7hԅ`ZiOJY)%YD\S.~ᷮrpK1_ѾBM: $⃺ҙOEmꞪvj?^J3:_jQc2.RXXcF{I͝uTA!v{)t ƌi&gG\f,7-H?B2#`j#j { Ht<& #18]#(PY pupdØ /,8hJ\ E/5}"nX;R³w}<$Yi*k:t |: (xĽ)Q:#rN_;YOG@))ipͺ lAC=X)\gYZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata  & 4$Go00@Q ppYaovno }*BIIhYYYY dd ooB    ЄpG%pGxG%xGG%G (H%(H HJ%HJP%Pp %0 f( (/>